KEGG   Meleagris gallopavo (turkey): 100540537Help
Entry
100540537         CDS       T01523                                 

Definition
arginase-2, mitochondrial-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mgp01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mgp00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 314 aa AA seqDB search
MSLAWTEELLRVQRPSAGGLGGCQLFDFGDLNFTQVPNDELYNNLIYYPRSVGLASQVLA
DAVSRAVAAGHSCVTIGGDHSLALGSISGHARQCPHLGVIWVDAHADINTPLTTPSGNLH
GQPLSFLLRELQDKVPQLPGFSWLKPCLSASDIVYVGLRDVDPAEYYILKNYDIQYFSMR
DVDRLGIQKVMERTFEQLMGRRQRPIHLSFDIDAFDPSLAPATGTPVLGGLTYREGMYIA
EEIHNTGMLSAVDMVEVNPLLGASQEEVNATANLAVDVIATCFGQTREGAHTAFDELPTP
SSPDESDSEEQVRI
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggcatggactgaggaactgttaagagtgcagagaccatctgctggagggctg
ggtggatgccaactgtttgactttggagatttgaatttcactcaagttcccaatgatgaa
ctgtacaacaacctgatttattacccacggtcagtggggttagccagccaggtactggcc
gatgctgtaagcagagcggtagctgctggacacagctgtgtcactataggaggtgatcac
agcttggcacttggttccatcagtggccacgcacgacagtgcccacatctcggtgtgatc
tgggtggatgcacatgctgatattaacactcctcttacaactccgtctggaaacctccat
ggacagcctctctcatttctcttgagagaacttcaagataaagtcccacaacttcctggc
ttttcctggctaaagccctgtctttcagcatctgatattgtgtatgttgggttgagggat
gtggatcctgctgaatactatattttgaaaaactatgacatccagtatttttccatgagg
gatgttgatcgccttggaatccagaaagttatggaaaggacatttgaacagctgatgggc
aggagacagagaccaattcacctgagttttgacatcgatgcttttgatccctcactggct
ccagcaactgggactcccgttctgggtggattaacttacagagaaggcatgtacattgca
gaggaaatacacaacacaggaatgctttcagctgtagacatggttgaagtcaatccgctg
cttggagcttctcaagaggaagtgaatgcaactgctaatcttgcagttgatgtgatagca
acatgctttggacagacaagagaaggggcgcacaccgcttttgatgaactcccaacaccc
agttctccagatgaatctgacagtgaagagcaagtgaggatttaa

DBGET integrated database retrieval system