KEGG   Meleagris gallopavo (turkey): 100540537Help
Entry
100540537         CDS       T01523                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100540537 (ARG2)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100540537 (ARG2)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100540537 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 320 aa AA seqDB search
RDHIFNLCFPLDPCLITPLSLFVVVFPGCQLFDFGDLNFTQVPNDELYNNLIYYPRSVGL
ASQVLADAVSRAVAAGHSCVTIGGDHSLALGSISGHARQCPHLGVIWVDAHADINTPLTT
PSGNLHGQPLSFLLRELQDKVPQLPGFSWLKPCLSASDIVYVGLRDVDPAEYYILKNYDI
QYFSMRDVDRLGIQKVMERTFEQLMGRRQRPIHLSFDIDAFDPSLAPATGTPVLGGLTYR
EGMYIAEEIHNTGMLSAVDMVEVNPLLGASQEEVNATANLAVDVIATCFGQTREGAHTAF
DELPTPSSPDESDSEEQVRI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
agagaccatattttcaatttgtgttttcctttggatccttgtttaataactcccctttct
ctttttgttgttgtgtttccaggatgccaactgtttgactttggagatttgaatttcact
caagttcccaatgatgaactgtacaacaacctgatttattacccacggtcagtggggtta
gccagccaggtactggccgatgctgtaagcagagcggtagctgctggacacagctgtgtc
actataggaggtgatcacagcttggcacttggttccatcagtggccacgcacgacagtgc
ccacatctcggtgtgatctgggtggatgcacatgctgatattaacactcctcttacaact
ccgtctggaaacctccatggacagcctctctcatttctcttgagagaacttcaagataaa
gtcccacaacttcctggcttttcctggctaaagccctgtctttcagcatctgatattgtg
tatgttgggttgagggatgtggatcctgctgaatactatattttgaaaaactatgacatc
cagtatttttccatgagggatgttgatcgccttggaatccagaaagttatggaaaggaca
tttgaacagctgatgggcaggagacagagaccaattcacctgagttttgacatcgatgct
tttgatccctcactggctccagcaactgggactcccgttctgggtggattaacttacaga
gaaggcatgtacattgcagaggaaatacacaacacaggaatgctttcagctgtagacatg
gttgaagtcaatccgctgcttggagcttctcaagaggaagtgaatgcaactgctaatctt
gcagttgatgtgatagcaacatgctttggacagacaagagaaggggcgcacaccgctttt
gatgaactcccaacacccagttctccagatgaatctgacagtgaagagcaagtgaggatt
taa

DBGET integrated database retrieval system