KEGG   Meleagris gallopavo (turkey): 100540537Help
Entry
100540537         CDS       T01523                                 

Definition
arginase-2, mitochondrial-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100540537
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100540537
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100540537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 314 aa AA seqDB search
MSLAWTEELLRVQRPSAGGLGGCQLFDFGDLNFTQVPNDELYNNLIYYPRSVGLASQVLA
DAVSRAVAAGHSCVTIGGDHSLALGSISGHARQCPHLGVIWVDAHADINTPLTTPSGNLH
GQPLSFLLRELQDKVPQLPGFSWLKPCLSASDIVYVGLRDVDPAEYYILKNYDIQYFSMR
DVDRLGIQKVMERTFEQLMGRRQRPIHLSFDIDAFDPSLAPATGTPVLGGLTYREGMYIA
EEIHNTGMLSAVDMVEVNPLLGASQEEVNATANLAVDVIATCFGQTREGAHTAFDELPTP
SSPDESDSEEQVRI
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggcatggactgaggaactgttaagagtgcagagaccatctgctggagggctg
ggtggatgccaactgtttgactttggagatttgaatttcactcaagttcccaatgatgaa
ctgtacaacaacctgatttattacccacggtcagtggggttagccagccaggtactggcc
gatgctgtaagcagagcggtagctgctggacacagctgtgtcactataggaggtgatcac
agcttggcacttggttccatcagtggccacgcacgacagtgcccacatctcggtgtgatc
tgggtggatgcacatgctgatattaacactcctcttacaactccgtctggaaacctccat
ggacagcctctctcatttctcttgagagaacttcaagataaagtcccacaacttcctggc
ttttcctggctaaagccctgtctttcagcatctgatattgtgtatgttgggttgagggat
gtggatcctgctgaatactatattttgaaaaactatgacatccagtatttttccatgagg
gatgttgatcgccttggaatccagaaagttatggaaaggacatttgaacagctgatgggc
aggagacagagaccaattcacctgagttttgacatcgatgcttttgatccctcactggct
ccagcaactgggactcccgttctgggtggattaacttacagagaaggcatgtacattgca
gaggaaatacacaacacaggaatgctttcagctgtagacatggttgaagtcaatccgctg
cttggagcttctcaagaggaagtgaatgcaactgctaatcttgcagttgatgtgatagca
acatgctttggacagacaagagaaggggcgcacaccgcttttgatgaactcccaacaccc
agttctccagatgaatctgacagtgaagagcaagtgaggatttaa

DBGET integrated database retrieval system