KEGG   Meleagris gallopavo (turkey): 100540654Help
Entry
100540654         CDS       T01523                                 

Gene name
USP48, USP31
Definition
ubiquitin specific peptidase 48
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100540654 (USP48)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100540654 (USP48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 1137 aa AA seqDB search
MFELNIVSKNAMQYRGNAQHDAQEFLLWLLDRVHEDLNNVVNYSGMPPLKPPLEDDVLLE
GPAFPISSTFVQELFQAQYRSSLTCPHCQKQSNTFDPFLCISLPIPLPHTRPLYVTVVYQ
GKCSHCMRIGVAVPIAGTVARLREAVSSETKIPTEQIVLTEMYYDGFHRSFCDTDDLDTI
HESDCIFAFETPEIFRPEGILSQRGIHVNNNLNNLKYGTEHSRTVSYSQGTVVSGKLEQS
STRQGANDKIVLLVCNRACTGQQSKRFGLPFVLHLEKTIAWDILQKEILEKMQYFLRPAA
CLQVCPFSLRVVSVVGITYLLPQEERPLCHPTVERALKSCGQGGTAHVKLVVEWDKETKD
FLFVNTEDEYIPDSESVRQQRELHHQPQTCTLSQCFQLYTKEEQLAPDDAWRCPHCKQLQ
QGSITLSLWTLPDVLIIHLKRFRQEGDRRMKLQNMVKFPLSGLDMTPHVVKRSQSSWSLP
SHWSPWRRPYGLGRDPEDYIYDLYAVCNHHGTMQGGHYTAYCKNSVDGQWYCFDDSDVQQ
LSENEVCKQTAYIFFYQRRTAIPSWSANSSVAGSTSSSLCEHWVSRLPGSKQPSIASAAS
SRRTSLASLSESVELTGERSEDDGDFKVSSQPFCDTQLMALLXSRSSVTSPLAVSENGVR
PSWSLSAKLQMRSNSPSRFSGDSPVHTSASTLEKIGEAADDKVSTSCFGSLRNLSSSYLE
PCDGGRREHKAARRAPLAVMEGAFREEPVVRTSSSDLSDGLGKSSEQPDRSHPALDPFDN
NNQIAFVDQSDSVDSSPVKEVKAPSGTGLAPEKMEGTPKKAHSSKGASESDRMRKGRTVL
STQETKVSRSSPPLKSSQKVSRSRSKTDASRATGRHGSPAPTQARKDHSTKSAEVTVPLA
QQKQKSGSSPSSTAAKKAASGSLTKGSSAGKSRTSERSLSREGSKISLGSDKTSVTSSSR
TSSPRISHSRSDSRAVDSKHTRSSSMANLRSPNVGMRSGLKRDSKSEEKGLSFFKSALRQ
KETRRSADLGKTTMLSKKAAGGSSKSASKNALEDKSEKGGVPPASQTNANVTAKEKLVPK
DAAPNKHSLLSSRKSKSSLLDPGARSPPSSGKQAADKPLKRLPSSMQVSVRPSMEPQ
NT seq 3414 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagctgaacattgtgtccaagaatgccatgcagtaccgtgggaatgcccagcac
gacgcgcaggagttcctgctctggcttctagacagagtccacgaggatctgaacaacgtg
gtgaattacagcggcatgcctccactcaagccaccgctggaggatgatgtgctcctcgag
ggaccagcctttcccatcagtagtactttcgtacaggaactctttcaagctcagtacagg
tcctctctgacgtgccctcattgccagaagcagagcaacacctttgacccttttctttgc
atctctctgccgattcctttgcctcacacgcggccactctatgtcactgtggtgtaccag
gggaagtgctcgcactgcatgcgcatcggggtggctgtacccatcgctggcacagtggcc
aggctgcgggaggctgtgtcctcagaaaccaagatacccactgagcagattgtgctgacg
gagatgtactacgatgggtttcatcgttccttctgtgacactgatgacctggacacaatt
catgaaagtgactgcatttttgcctttgagaccccggaaatatttaggcctgagggtatc
cttagtcagagaggaatacatgtgaacaataacctgaataacttaaaatatggcactgaa
cactcacgaacagtatcatactctcaaggaactgtggtgtctggaaaactggaacagtcc
tctacgagacaaggagcaaatgacaagattgtcttgctggtgtgtaatagagcatgcact
ggacagcagagcaaaaggtttggcttgccctttgtgttgcatttggaaaaaacaattgct
tgggatattctgcagaaggaaatcttggagaagatgcagtatttcctgcggcctgcagcc
tgcttgcaggtctgcccattcagcttgcgagtggtcagtgttgtgggcataacgtatttg
ctacctcaggaggagcggcccctctgccatccaacagtggaaagggcattgaagtcatgt
ggacaggggggaactgctcatgtgaaattagtcgtagaatgggacaaagaaactaaagat
tttttgtttgtgaacacagaggatgagtatattccagactctgaaagcgtccgccagcag
agagagcttcatcaccaacctcagacctgcactttatctcagtgtttccaactgtatacc
aaagaggagcagcttgccccagatgatgcatggcgatgcccacactgcaagcagctacag
cagggtagcatcacgctgagcctctggaccttacctgatgttctcatcatacacctcaaa
aggtttaggcaggaaggagaccgaaggatgaaacttcaaaacatggttaaatttcccctg
agtggtttggacatgacccctcacgttgttaagcgcagtcagagcagctggagtctgcca
tcccactggtcaccctggaggcgaccttatggtcttgggagggatcctgaggactatatc
tatgacctgtacgcagtctgtaatcatcatggcaccatgcaagggggacactatacagca
tattgcaaaaactcggttgatggccagtggtactgctttgatgacagtgatgttcagcag
ctttctgaaaatgaagtctgcaagcagacagcatatatctttttctaccagagacgcaca
gcaatcccatcatggtctgctaacagctctgtggcaggctccacaagctcctcactctgt
gagcactgggtcagccgtcttcctggcagcaagcagcccagcattgcttctgcagcatca
tcacggcgtacgtctctggcttcgctctcggaatcggtggagctgactggagaaaggagt
gaggatgatggggactttaaagtttcttctcaaccattctgtgacactcaattgatggca
ttgcttncatccagatcttctgtcaccagcccactggccgtgagtgagaatggtgtcagg
ccctcgtggtcactctctgcaaaactgcagatgcgctccaactctccatcgcgcttctct
ggagactcccctgtacacacctctgcttccaccctggagaagattggggaggctgctgat
gataaagtctccacctcttgctttggcagcttgaggaatctctctagcagctacttggag
ccctgtgatggtggccggcgagagcataaagcagctcgcagggcccccttggctgtcatg
gaaggggcattcagggaagagcctgttgtaaggacatcgagctcagatctttcagatggg
cttggtaagagttctgagcagccagacaggagtcaccctgctttggatccttttgataat
aacaatcaaatcgcctttgttgatcagagtgattctgtggatagctctccagtcaaggag
gtgaaagcccccagtgggacaggactggctccagagaaaatggagggaaccccaaagaag
gctcacagctccaagggagcttctgaatcagacagaatgaggaaaggaaggacggtctta
tctacccaagagactaaagtgtctcgctcttctcctcccctcaagagttcccagaaggtt
tcccggtctaggagtaaaaccgatgcctctagggccactgggcgacacgggtctcctgca
cccacccaggctaggaaagaccatagcaccaagtctgctgaggtgactgtcccgttggct
caacagaaacaaaagtcaggttcttctccatcctccacagctgccaagaaagccgcatca
ggctcattgactaagggctcttctgctgggaagagccggacttcagaacgaagcctcagc
agggagggctctaaaataagcctggggtcagataaaacaagcgttaccagcagttcgaga
acaagctccccgcggatcagccactccaggagtgacagcagggcagtagacagcaagcac
acgcggagctcctcaatggcaaacctgcggtctccaaatgttggtatgcgttctggtttg
aagagagacagcaagtcggaagagaagggattgtctttctttaaatcagccttaaggcag
aaggagacccgtaggtcagctgacctgggaaagacaacgatgctctcgaaaaaggcagcg
ggtggcagctccaaatcagccagcaaaaatgcgctggaggacaaatctgagaaaggtggt
gtcccaccagcctctcaaaccaatgccaacgttactgcaaaagaaaaacttgtcccaaaa
gatgccgcacccaacaaacattctctgctatccagccgcaagtccaaatcttccctgcta
gatcctggagcccggtctcctccttccagtggcaagcaggctgcagacaagccactgaaa
aggttaccttccagcatgcaggtgtctgtacggccttctatggaacctcagtga

DBGET integrated database retrieval system