KEGG   Meleagris gallopavo (turkey): 100540662Help
Entry
100540662         CDS       T01523                                 

Definition
histone-lysine N-methyltransferase MLL-like
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100540662
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100540662
Transcription factors [BR:mgp03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100540662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
26
AA seq 3851 aa AA seqDB search
MFDERLYISKSFFDGWGGMDEQFLGFGSDEEIKVQSPTRSPTVKSSPRKPRGRPRSSSDR
SSAVLSDSSSVCSPSSKSETTSMEKVKKKDLKSGEKRRGRPPTLTSVKFKLSQVKDTSDI
QKGSKEDKESLKKIKRSPSTTFQQATKIKKLRTSKLSPLKSKFKPGAKLQIGRKSVQIVR
RRGRPPSSERLKTSSSLVINSQLEKPQRIRKEKDGTPPPTKEEKTAVRQSPRRIKPVRII
PSTKRTDATIAKQLLQRAKKGAQKKIEKEAAKLQGRKGRTQLKNIRQFIMPVVSAISSRI
IKTPKRFIEDEDYDPPIKISRLESTPNSRFSATSCGSSEKSSAASQHSSQMSSDSSRSSS
PSVDTSTDSQASEEMQTLSEERSNTPEVHTPLPVSQSPENDNGDRRNRRFSITERSFGQR
AAKKLSALPSVPQQQSSSSPPPPLLTPPPPLQPASGISDHTPWLMPPTIPLASPFLPTSA
APMQEKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDV
GFASGFSTPGATAPARLFSLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSSVG
RTTTGTSATGVSSRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSTSDLTTLTPQSSVSSSL
TSISVSSLATSALNSTFTFPSHSLTQSGESAERSQRQRKQTSTPAEPFSSSSPTPLFPWF
TTSPQTERGRNKDRATEELSKDKDADKSVEKDKSREKDREREKENKRESRKEKRRKGSEI
QSSSALFPVGKMPKEKVVSEDVAASSSAKKXAGRRKSTAIDPVADVSTAALVDTTAIKTK
TSKKGRGGLDKSDLDLSPAVPSLEKEKALRLSTPASSTVKHSASSISSMLAQADKLPMTD
KRVASLXKKAKAQLYKIEKSKSLKQADQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEEAEPLAPPIKPIKPVTRNKA
QQEPPVKKGRRSRRCGQCSGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWM
PSKAYLQKQAKAAKKKEKKSKTNEKKESHSGKNQLDSGQKPTPPAVVPREDSAVKKSSEP
ARKPVEEKHEDGNSSAPPPEPKQTPASGTRKTGKQTAQPVQLPPSQPPSSGPLKKEAPKV
TTSEPKKKQPPQPEIGTEQNKQKKIAPRPTFPVKQKPKEKEKPPPISKPENSTLNLLSTL
TNGSSSKQKPPTDGVHRIRVDFKEDCEVENVWEMGGLGIVTSVPITPRVVCFLCASSGHV
EFVYCQVCCEPFHKFCLEESERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRN
SYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLF
AKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCIN
CTEQHPAEWRLALEKELQVSLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSR
SSPEGPDPPVLTEVSKQEEQQPLDMEGVKRKMDQGGYISVLDFSDDIVKIIQAAINSDGG
QPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVTSNSGMLPNAVLPPSLDHNYA
QWQEREENNHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPISGSDRSREDSPELNP
PPDVEDNRQCALCLKYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHM
AVIRGKQLRCEFCQKSGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKG
EVVPENGFEVLRRVFVDFEGISLRRKFLSGLEPENIHMMIGSMTIDCLGILNDLSDCEDK
LFPIGYQCSRVYWSTTDARKRCVYTCKIMECRPPVVEPDINSTVEHDDNRTIAHSPVPLT
ETLFKDSRNTPEIVNPPSPDRPMHSQTSSSCYYPTVSKGLRIRTPSYPSTQRSPGSRPLP
SAGISSPMTHEIVTVGDPLLSSGLKSIGSRRHSTSSLSQQQSKLRMISPTRAGNTYSRHS
LSSVSSIGSSSEHEQSTKTADHFVGSVNSGTTSAPVQSCSSSSGSQKTAAASGTKTYQLD
ASQSTEGKHPSSSDLVAKSAPSKGEKVKTLTSRDPDYSAHSFSSGGNSKTSTQPNSSSGT
EINVKIGTFQESAGSFSSKETVSFPSLHQRGPRKDRDQHLESVQPEKTTSVDEIDAKMLK
SAGVNSRSPAASEQVVSATRDRRQKGKKIVKESFKEKHSLKSLTDSSQAGGGDEGNLTSE
FGNQGLVTEQISQRLCNNIPAEKNVEKSPPSQGSSKSSVVLPEVAPKESQAPRKRTVKVT
LTPLKMESEGQSKAAQQEGDAEPQPAGTELASSAEPSSNSESPEDNSVVQGSPNKAPTQE
SQNNAYENLPVQDNNLMLQDGTKAQEEGSYKRRYPRRSARARSNMFFGLTPLYGVRSYGE
EDIPFYSNSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVVSSNTEERLASHNL
FREEEQCDLPKISQLDGVDDGTESDTSVTATTRKVNQVTKRSGKENGTENLKLDRTEESG
EKVQVTKSPAVHKTDPKMDNCHPVSRVKTQGQDSLEAQLSSLETGRRAHASTPSDKNLLD
TFNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLTLGEGLG
LDSNRGKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVP
SQNHNRLAVISESSLSSSGERSMLALPSTESGEKRVTVTEKSTSSEGDAALLSPGVDPSP
EGHMTPDHFIQGHIDAEHIASPPCGPVEQGHGSNQDLTRNSGTPGIQVPVSPTVPLQNQK
YVPNSTDSPGASQISNAAVQTTPPHLKPAAEKLLVVNQNMQPLYVLXTLPNGVTQKIQLT
PSVSSAQSVMETNASVLGPVGSGLTLTTGLNPSLPSSQSLYPPTSKGLLPMSHHQHIHPF
STATQTGFPPNIGSPSPGLLIGVQPPPDPQLLVSEANQRTDLGTTASTPAAALSKKRPIS
RLQSRKNKKLAPSGTPSAIAPPDMVSNMTLINFAPSQISNHPLDLGTXXXXXMYFEQTSL
LPQSGTASAVGTSPSVIGPDAGHLPTGPVSGLASSSSVLNVVSMQATAAPTTGGSVPSHV
LGQSSVTLTSPGLLGDLGSISNLLIKASQQSLGLQEQHMTLPPASGMFSQLGTSQTPSTA
AMTAASSICVLPSAQSMSMTVAQSSTDPEGSYQLQHMTQLLASKTGIASSQLDLGAASAT
AQLSSFSQLVDVPNSTRLEQNKVSSSVMHASSASPGGSPSSGQQSASSSVLGSSKMKPKI
KRIQPSLEKGNGKKHKTSHMWTGSSEAHVPDRGTTAAPQVSAARTPAVKTDVQDAASTDQ
PSQTQCGQSTGQTAVLPESQSTKTSTNEQENAGSKAFEEEESTFSSPLMFWLQQEQKRKE
CLGEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLR
MLGIIHDTVVFLIEQLYGAKHCHNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMF
NFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPI
HGRGLFCKRNIDAGEMVIEYSGNVIRSILTDKREKYYDSKGIGCYMFRIDDSEVVDATMH
GNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCN
CGAKKCRKFLN
NT seq 11556 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgagaggttgtatatttccaagtcgttttttgatggctggggcgggatggat
gaacagttcctaggttttggttcagatgaagaaatcaaagtacaaagtcccacccggtcc
cccacagttaaatctagtccacgaaaacctcgtgggaggccccggagcagttctgaccga
agttcagctgtactgtcagactcttcatcagtgtgttccccttcaagcaagtctgaaacc
acatccatggagaaagtaaagaagaaggatctgaaaagtggggaaaaaagacgaggaaga
cctccaacgcttactagtgtaaagttcaagttgtcgcaagtaaaggacacatcagatatt
cagaagggaagcaaagaagataaagagagtctgaaaaaaatcaaaaggtcaccatccact
acatttcagcaagcaactaaaattaagaaattaagaactagtaaactctccccactaaaa
tctaaatttaagcctggggcaaaacttcaaatagggaggaaaagtgttcagattgtgcgc
aggagaggaaggccgccatcttctgaacgtttaaagacttcctcgagcttggtcataaat
tcacagctggagaaaccccaaaggatacgtaaagaaaaggatggcacgccgcctcctacg
aaggaagagaagactgctgtcagacagagtccacgcaggattaagcctgttaggatcata
ccctccacaaaaaggacagatgcaacaatcgctaagcaactcttgcagagggctaagaag
ggggcacaaaaaaagattgagaaagaagcagccaaattgcagggcagaaaggggagaacc
cagcttaaaaacatccggcagttcatcatgccagttgtaagtgctatctcttcacggatt
attaaaacacccaagcggttcattgaagatgaagactacgaccctcctatcaaaatatcc
cgactagaatccacgccaaacagcaggttcagtgctacatcttgtggatccagtgaaaaa
tccagtgctgcttctcagcattcatctcagatgtcttcagactcctcccggtccagtagc
ccaagcgtcgatacgtctacggactctcaggcttctgaggagatgcagactctttctgag
gagcgaagtaatactccagaagttcacacacctctacccgtttctcagtcccctgagaat
gataacggcgacaggagaaacagaaggttttccataacagaaagaagttttggccagagg
gctgctaaaaagctgtcagccttgccaagtgtgccacagcagcagtcctcctcctctcct
cctccccctctgctcactcctcccccaccactacaacctgcttctggcatctcagaccac
actccctggcttatgcctcctaccatacctttagcctcaccctttcttcctacttctgct
gcaccaatgcaagagaaacgtaaatcaattctacgagagccaacgtttaggtggacctct
ctgaagcattccaggtcagaaccacagtacttctcatcagcaaaatatgccaaagagggt
cttattcgcaaaccaatatttgataactttagacccccaccgctgacaccggaggacgtt
ggctttgcatctggcttctcgacgccaggtgctacggctccagcacgtctgttttctctt
cattctggaacaagatttgatatgcacaagagaagtcctctgttgagagctccgagattc
actccaagcgaggcccactccagaatctttgaatctgtaactttgccctcatccgttggt
cgaaccactacgggaacttctgcaacaggtgtctcttctaggaaacgaaagagaaaagtg
tttagccctatccgctcagaacccagatctccttcgcactccatgaggaccagaagtggg
agacttagtacctctgacctgacaactctcaccccacagtcttctgtctcttcctcatta
actagcatttctgttagttctcttgccactagtgccttaaattcaacttttacttttcct
tcccattccctaacacagtccggggaatcagcagaaagaagccagagacaaaggaagcag
actagcactccagcagagcctttctcatctagtagtcctactcctctctttccttggttc
acaacaagtccccagacagagagaggcagaaacaaagacagggcaacagaggaactgtcc
aaagataaagacgctgataagagtgtggagaaggacaagagcagagagaaagacagagag
agagagaaggagaacaaacgtgagtcaaggaaagagaaaaggagaaaagggtcagaaatt
cagagtagctctgctttgtttcctgtaggtaaaatgcccaaagaaaaagttgtcagtgaa
gatgttgcagcatcatcttctgcaaaaaaanctgccgggcggaggaagtctacagcaata
gatcctgtggcagatgtttccactgctgctctggtagatacaacagccatcaaaaccaaa
acatccaagaaaggtagaggggggttagacaaatcagatctggacctcagccctgctgtg
ccgtctttggagaaggaaaaagctctgcgtctctctactcctgcttcaagcaccgttaaa
cattccgcttcctccatcagctctatgttggctcaagcagacaaactgccaatgactgac
aaaagggtagccagtcttnctaaaaaagcaaaagcccagctgtacaagatcgagaagagc
aagtccctcaaacaagcagatcagccaaaagcacagggacaagagagcgattcatcagaa
acgtcagtccgaggaccacgaataaagcatgtttgcaggagagcagctgttgccctgggc
cgtaagcgagcggtgtttcctgatgacatgcccactctgagtgccttaccgtgggaagag
cgagagaagatactgtcttccatggggaatgatgacaaatcatcaatagctggctctgaa
gaggctgaacctcttgctccacctatcaaaccaattaagccggtaacgagaaacaaggca
cagcaagagcctccagtgaagaagggccgacgctcaaggcgctgtgggcagtgctcaggc
tgtcaggttccagaggattgtggtgtctgcactaactgtctggacaaacccaagtttggt
gggcggaatataaagaagcagtgctgcaaaatgagaaagtgtcagaatctacagtggatg
ccttcaaaagcatatctccagaagcaagctaaagctgcaaaaaagaaagagaagaaatcc
aagacaaatgaaaagaaagaaagtcattctgggaagaaccaactggactctggacagaaa
ccaactcctccagctgttgtaccaagagaagacagtgctgtaaagaagagcagcgagcct
gctcgtaagcctgtggaggagaagcatgaggatgggaattcctctgctcccccaccagag
cccaaacagacccctgcatctggtaccagaaagactggcaaacaaacagcccagccagtg
cagctccctccatctcagccaccgagctcaggacctttgaaaaaggaagcaccaaaagtt
actacttctgagcctaagaaaaagcagcctccacagccagaaataggcacagaacaaaac
aaacagaaaaaaattgctccccgtccaactttccctgtgaaacagaaaccaaaagaaaag
gaaaagccccctcctataagcaagccagaaaacagcacgctgaatttgctcagcactttg
actaatgggagcagttccaagcaaaagccacctacagatggagtccacagaatccgagtg
gatttcaaggaggactgtgaagtggagaatgtttgggagatgggtgggttaggcatcgtg
acctcggtacctattactcccagggtggtgtgttttctctgtgccagcagtggacatgtg
gagtttgtgtattgtcaggtctgttgtgagcctttccacaagttctgcttagaggagagc
gagcggcccctggaggaccagctggaaaactggtgctgccgtcgctgcaagttctgccac
gtgtgtgggagacagcaccaggccaccaagcagctgctggaatgtaacaagtgccgaaac
agctatcaccccgagtgcctgggcccaaactacccaaccaaacccaccaagaaaaagaaa
gtttggatatgtaccaaatgtgttcgctgcaaaagctgtggatccacaacgccaggcaaa
gggtgggatgctcagtggtctcatgacttctcactgtgtcatgattgtgccaaactcttt
gctaaagggaatttttgtcccctctgtgacaaatgctacgatgatgatgactatgagagt
aagatgatgcagtgtgggaaatgtgaccgctgggtacactccaaatgtgaaaacctttct
gatgaaatgtatgagatactctctaacttgcctgagagtgtagcatacacctgcattaac
tgtacagaacagcaccctgcggaatggcgtcttgcactggaaaaggagttgcaggtttct
ttaaaacaggttttaacagccctattgaattctagaaccaccagtcacttgctgcgttac
agacaggcagcaaaaccacctgatttaaatcctgagacagaggagagtatcccatcgaga
agctctccagaaggccctgatcctcctgttctaacagaagtcagtaaacaagaggagcag
caacctctggatatggaaggagtgaaaagaaaaatggatcaaggaggttacatttctgtg
ctggattttagtgatgatattgtgaagataattcaagcagcaattaattccgatggaggg
cagccagaaattaaaaaagccaatagcatggtcaagtccttctttattcggcaaatggaa
cgtgtttttccatggtttagtgtaaagaagtccagattttgggagccaaataaagtaaca
agcaacagtggtatgttgccaaatgcagtgctccctccttcgcttgaccataattatgct
cagtggcaggagcgtgaagagaacaaccacactgaacagcctcctctgatgaagaaaatc
attccagctccaaaacccaaaggacctggagagccggattcacctactcctctacatcct
cctacaccacctatctctggttctgacagaagcagagaagatagtcctgagcttaatcca
cctccggatgtagaagacaacaggcagtgtgccttgtgcctgaaatatggtgatgatagt
gctaatgatgctggacgccttctctatattggccaaaatgagtggacacatgtgaactgt
gctttatggtcagcagaagtatttgaagatgatgatggttctctgaaaaacgtgcacatg
gctgtgatcaggggaaagcaactgagatgcgagttctgccagaagtcaggtgccacagtg
ggctgctgcctcacttcctgcacaagtaactatcatttcatgtgctcacgagccaagaac
tgtgtttttctggatgataagaaagtttactgccagaggcaccgtgatttgatcaaagga
gaggtggttcctgagaatgggtttgaagttcttaggagagtttttgtggattttgaaggg
atcagtttgagaagaaagtttcttagtggcttggaaccggagaacatccacatgatgatt
ggttcaatgacgatagactgtttaggaattctgaatgacctctcagactgtgaagataag
ttgtttcccattggctatcagtgctccagggtgtactggagtacaacagatgccaggaaa
cgctgtgtgtatacctgcaagatcatggaatgccgaccgccagtcgtagaacctgatatc
aatagcactgtagaacatgatgataacagaacaattgcccatagcccagttccccttaca
gaaactctattcaaagacagcagaaatacacctgaaattgtaaacccaccatctccagat
cgtcccatgcattctcagacctctagttcctgttattatcccacggtctcaaagggtctt
aggatcaggacaccaagttatccatccacacagaggtctcctggctctaggcctttaccc
tctgcaggtatttcaagcccaatgacccatgaaatagttacagtgggagatcctttacta
tcctctggacttaagagcattggttctagaagacatagcacttcttcattgtcacagcag
cagtcaaaactccggatgatttcacctacacgagctgggaatacttactccagacacagt
ctgtcttcagtttccagcatagggtcctcttcagaacatgaacagagtacaaaaactgct
gaccactttgtgggatctgtgaattcaggtaccacaagtgctccggttcaaagctgctct
tcgagttcgggctcccagaagacagcagctgcaagtggaactaaaacttaccagctggat
gcatctcagtctacagaaggaaaacatcctagtagttcagatttggtagccaaaagcgca
ccttcaaagggagagaaggtgaaaacgctgacctcaagggacccagattattcagctcat
agtttttcttctggaggaaactccaaaacatcaactcaaccaaacagttcatcaggcaca
gaaataaatgttaaaataggaacctttcaagaatctgcaggatcattttcttctaaagaa
acagtatcctttccatctttgcatcagagaggcccaaggaaagacagagatcagcacttg
gaatctgtacagccagaaaaaactacttcagttgatgagatagatgcaaagatgctgaag
tctgcaggagtaaatagcagatctcctgcagcaagcgagcaggtagtttctgccaccaga
gacaggcgtcagaaggggaaaaagatagtgaaagagagttttaaagagaagcattccttg
aaatctcttacagattcaagtcaggcaggaggcggtgatgaaggaaatctgacatcagaa
tttggtaatcagggtttggtgactgaacaaattagtcagaggttgtgtaataatattcct
gctgaaaaaaatgttgagaagtctccaccttcgcaggggtcgtctaaaagttctgtagtg
ctgcctgaagtggcccctaaggaatcacaggcacctagaaaacgcaccgtcaaagtcact
ctgactcctctcaagatggaaagcgaaggccagtctaaagctgcacagcaggaaggtgat
gctgaacctcagcctgcagggacagagcttgcctcttcagcagagccctcctcaaattct
gaaagcccagaagataactctgtagttcaaggaagtccaaataaagcaccaacacaggaa
tctcaaaataatgcatatgaaaacttgcctgttcaagataacaacttgatgcttcaggat
gggactaaagctcaagaagaaggctcatacaagcggaggtatccacggagaagcgctcgg
gccaggtctaatatgttctttggactgactcctctgtatggtgtgaggtcttatggagag
gaagacattccattctacagtaactcaacagggaagaagcgagggaagcggtctgcagaa
ggacaggtggatggtgcggatgatttaagcacgtcagatgaggatgacttgtactactat
aatttcactagaacagtggtttcctctaacactgaggagaggcttgcatcccataactta
ttcagggaggaagagcagtgtgatcttccaaaaatctcccagttagatggtgtagatgat
gggactgaaagtgatacaagtgtcacagccacaactagaaaagtaaatcaagtaactaaa
aggagtggtaaagaaaacggaacggaaaacttaaagctggatagaactgaagaaagcggg
gagaaagtacaggtcacaaaaagccctgctgtccacaaaactgatccaaagatggataat
tgtcatcccgtgagcagggttaaaacacaaggtcaggattctctggaagctcagctgagc
tctttggaaacgggccgtagggctcatgcaagcacaccttctgataagaacttgctggat
acttttaacacagaacttctgaaatctgactctgacaataacaacagcgatgactgtgga
aacatcctcccgtcagacatcatggattttgtactgaagaacacgccgtccatgcaggct
ttaggagaaagtccagagtcctcatcatctgaacttctaacacttggagaaggtttaggc
cttgatagcaaccggggcaaagacatgggtctgtttgaagtgttttctcaacagctgcca
acaactgagccagtggatagcagtgtttcttcgtccatatcagcagaggagcaatttgaa
ttaccactggaacttccttctgatctttctgttctgactactcgcagcccaacggtgccc
agtcagaatcacaacagacttgccgtcatttcagagtcttcgctgtcctcttcaggagag
aggtcaatgcttgccttgccctccacggaatctggggaaaaaagagttacagtcacagaa
aaatccacctctagcgagggcgatgcagctcttctgagtccaggagtagacccgagccct
gaagggcacatgactcctgaccacttcatccagggtcacatcgatgcagagcatatagcc
agcccaccctgtggcccggtagagcaaggacatggcagcaaccaggatttaactaggaac
agtgggactccaggtatccaagtgcccgtgtcacccaccgttcccctgcagaaccagaag
tacgttcccaattccacggatagtcccggcgcctctcagatttctaatgctgcagtgcag
acaacaccaccccacctcaagccagctgcagaaaagcttctcgtagtcaatcagaatatg
cagccactctacgtcctctaaacgcttcccaatggcgttactcaaaagatacagttgaca
ccttctgttagttcagcacagagcgtaatggagacgaatgcctcagtgctggggcctgta
gggagtgggctgacactgaccacaggattaaatccaagcttgccctcatctcagtcctta
tatcctcccacgagtaaaggattgttgcccatgtcccatcaccagcatatacatcccttc
tccacagccactcagactggcttcccaccaaatattggcagtccttcgccaggtctcctt
attggtgtgcagccaccccctgatcctcagctgttagtgtctgaagctaatcagaggact
gatcttggtaccactgcttcaacaccagctgcggccctgagcaagaaacggccaatatct
cgactgcagtcaaggaagaataagaaactggctccctctggaaccccttctgcaatagct
cctcctgatatggtctcaaacatgactttaattaattttgctccttcccaaatttccaac
cacccattggatttgggaaccnnnnnnnnnnnnntaatgtattttgagcaaacctctttg
ctcccccaaagtgggactgctagtgcagttggcacatctcctagtgttattgggccagat
gctggtcaccttccaactgggcctgtgtcagggctagcatcaagttcctcggtactgaac
gtggtgtccatgcaggccacagcagcccctactaccggtggctcagttcccagccatgtt
ttgggacaaagctcagtaacattaactagccctggattattaggggaccttggttccata
agcaacctcttgatcaaagctagtcagcaaagccttggtcttcaggagcagcacatgact
ttaccaccagcttctgggatgttttcacaactgggaacgtcacaaactccgtctacagca
gcaatgacagctgcatcaagcatctgtgttctgccttcagctcagagtatgagcatgaca
gttgcccagtcatctactgacccagaaggctcttatcagctccagcatatgacgcaactc
ttggccagcaaaactgggattgcttcctcacagctggaccttggtgcagcttcagcaaca
gctcagctgtcaagcttttcacagctggttgatgttcccaatagtaccagactggaacaa
aacaaggtttcctcatctgtaatgcatgccagttcagcatctcctggaggctccccgtca
tctggtcagcagtctgcaagtagctctgtgcttggctcatcgaaaatgaaaccgaaaatc
aaacgcattcagccgtctttagagaaagggaatggaaagaagcacaaaacttctcacatg
tggaccggttcctctgaagcacatgttcctgacagagggaccactgctgcaccccaggtc
tcagctgcacggactcctgctgtgaagacagatgtgcaggatgcagcaagcacagatcag
ccatcacaaacacagtgtggccagtctacagggcaaacggcagttctcccagaatctcag
tcaacaaagacctcaacaaatgagcaagaaaatgcaggctcaaaagctttcgaggaagaa
gagagcactttcagctccccacttatgttttggctgcagcaagaacaaaagaggaaagag
tgtcttggtgagaagaaacccaagaaaggtttggtttttgagatctcaagtgatgacggc
tttcagatctgtgcagaaagcattgaagatgcctggaagtcactgactgacaaagttcaa
gaagcccgttccaatgcccgcctgaaacagctatcatttgcaggtgtgaatggtttgagg
atgctggggattatccacgatactgttgtgtttctgattgagcaactttatggagcaaag
cactgccacaactacaagttcagatttcataaaccagaggaggccaacgaacctcctctg
aatccacatggctctgctagggctgaagtccacctgaggaaatctgcatttgatatgttt
aatttcttggcgtctaaacaccgacagccaccagaatacaatccaaatgatgaggaagag
gaggaagtacaactgaaatcagcccggagggcaacaagtatggacctgccaatgcccatg
cgattccgacacttgaagaagacttccaaggaggcagtcggtgtctacaggtctcccatc
catggccggggcctgttctgcaaaaggaacattgatgcaggtgagatggtgattgaatat
tcgggcaatgtcattcgctccatcctcactgacaaacgagagaagtactatgacagtaag
gggatcggttgctacatgttccgcattgacgactccgaagtggtggatgccaccatgcat
gggaatgcagcccgcttcatcaatcactcctgtgagcccaactgctactctcgggtcatc
aacatcgatggccagaagcacattgtcatcttcgccatgcgcaaaatctacaggggggaa
gaactcacgtacgactacaagttccccattgaagacgccagcaacaaactgccctgtaac
tgcggcgccaagaagtgcaggaagtttttaaactaa

DBGET integrated database retrieval system