KEGG   Meleagris gallopavo (turkey): 100540683Help
Entry
100540683         CDS       T01523                                 

Gene name
ITGB8
Definition
integrin, beta 8
Orthology
K06591  
integrin beta 8
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100540683 (ITGB8)
   04514 Cell adhesion molecules (CAMs)
    100540683 (ITGB8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100540683 (ITGB8)
  Cellular commiunity
   04510 Focal adhesion
    100540683 (ITGB8)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100540683 (ITGB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 713 aa AA seqDB search
MADSTQKGRCDTVFNLLKRGCQSDFVESPTVHVTIPSDQETNTQVTPGRVSVQLRPGSEA
SFILRVHPLEKYPVDLYYLVDVSASMHNNIEKLNSVGFALSKKMENISLDFRLGFGSYVD
KTVSPYISIHPGRIHNQCSDYNLDCMPPHGYIHVLSLTDNIAEFRNAVNKQKISGNIDTP
EGGFDAMLQAAVCQSHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVIPHDGNCHLKDNV
YVKATSMEHPSLGQLSEKLIDNNINVIFAVQGSQFHWYKDLLPLLPGTVARQIESQAANL
NDLVVEAYQKLISEVKIQVDNQIQDLNFNITAMCPDGSKKTGMEGCKNVGYNEEVLFNVS
VTMKGCDTTGGRKYAILKPIGFNETTIINVQKSCACQNGDNAKPKRVWVDETFPDGKQPH
CSDSSCSYSRETFPSEECRKHKDQPICSGQGDCIEGKCFCYKNKLGRVYGKYCEMDDFSC
PYHQGNLCSGNGECEAGKCKCFADWEGDRCQCSLQSAKQCLNSKGQICSGRGNCVCGKCE
CTDPRSFGRLCEYCPACNKACEENWNCVQCHHSNNASQAKLDQCKTSCAYLLHYVDQTSE
CFSGRSYFRVFSIIFIVTFLIGLLVVLIIRQIILQGNSNKVKSSADYRVSATKKIPLTRK
RLAAQALQRGMKPKLQPLKPEEERDPSFSHFFDTSHVYNKEKNFGTTLLLPWA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggctgactcaacacagaagggacgctgtgacactgttttcaacttactgaaaagaggc
tgccaatcggattttgtagaaagtcccacagttcatgttacaatacccagtgaccaagaa
acaaatacacaagtgactccaggaagagtttcagtccaactgcgtccaggaagtgaagca
agctttatattaagagttcatcctctggagaagtaccctgtggatctttactatttggtt
gatgtctcagcttctatgcacaacaacatagagaaactaaattctgttggatttgcttta
tctaagaagatggagaatatttctcttgattttcgacttggatttggatcctatgtggat
aaaacagtgtcaccctatattagcattcacccaggtagaatccataaccaatgcagcgat
tataatttagattgtatgccacctcatggttatattcacgtgctatccctgactgacaac
atagcagaattcagaaatgcagtgaataaacaaaaaatttctgggaatattgatacacct
gaagggggttttgatgcaatgctccaagcagctgtgtgccagagccacattggatggcgc
aaagaagccaagcgactacttcttgtgatgacagaccaaacttcccatctagccctagat
agtaaattagcagggatcgtgattccccacgatggaaactgccatttgaaagataatgtg
tacgtcaaagctacgagtatggagcatccatctcttggtcagctctctgaaaaattgatt
gacaataacatcaatgtcatttttgcagttcaaggaagccagttccattggtataaagat
ctgttacctctgttgcctggtactgttgcgagacagatagaatcacaagcagcaaatctc
aatgatttggtggtagaagcttatcagaaactaatctctgaagtgaaaattcaagtggat
aaccagatccaggatcttaatttcaatatcactgcaatgtgtcctgatggaagcaaaaaa
actggcatggaaggatgtaaaaacgttggatataatgaagaagttcttttcaatgtatca
gtcacaatgaaaggatgtgatacaactgggggaagaaaatatgcgatacttaagcctatt
ggtttcaatgaaaccaccattattaatgtacagaaaagctgtgcctgtcagaatggagac
aacgcaaagcccaagagagtgtgggttgatgaaacctttcctgatggcaaacagccccat
tgcagtgacagcagttgcagctacagcagagagacatttccttccgaggagtgcaggaag
cacaaggaccagcccatctgcagtggccaaggagattgcatagagggaaaatgtttctgc
tacaagaacaagctaggcagggtgtatggcaaatactgtgaaatggatgatttttcttgc
ccatatcaccagggaaacttatgttctggtaatggtgaatgtgaagccggtaaatgtaaa
tgctttgctgattgggaaggtgaccgttgccagtgttcattacaatcagcaaagcagtgc
ctgaattcaaagggccagatttgcagtggaagaggaaattgtgtatgtggaaaatgtgag
tgcactgacccaagaagctttggccgtttgtgtgaatactgccctgcttgtaacaaagcc
tgtgaagaaaactggaattgtgttcagtgccatcattctaacaatgcatctcaagctaaa
cttgaccagtgtaaaacctcatgtgcttacctattgcattatgttgaccaaacttcagaa
tgtttctctggacgaagctactttagagtattttccataatctttatagttacgtttctg
attgggttgcttgttgtacttatcatcagacagataattctgcagggaaatagcaataaa
gttaaatcttcagctgattacagagtctctgcgacaaagaagataccattgaccagaaaa
aggcttgctgctcaagctctccaaagaggaatgaaacctaagttacagcctctaaagccg
gaggaggaaagagatccttctttcagccacttttttgacaccagtcatgtctacaacaaa
gagaagaactttggaaccacactcctgctaccttgggcttga

DBGET integrated database retrieval system