KEGG   Meleagris gallopavo (turkey): 100540687Help
Entry
100540687         CDS       T01523                                 

Gene name
GLA
Definition
(RefSeq) galactosidase alpha
  KO
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo and isoglobo series
Lysosome
Brite
KEGG Orthology (KO) [BR:mgp00001]
   00052 Galactose metabolism
    100540687 (GLA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    100540687 (GLA)
   00600 Sphingolipid metabolism
    100540687 (GLA)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100540687 (GLA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100540687 (GLA)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100540687 (GLA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
9
AA seq 406 aa AA seqDB search
AARWALVAAVAAAAVVALDNGVARTPPMGWLHWERFLCGTDCAAEPDSCVSERLFTEMAD
VMVAEGWKEAGYEFVCIDDCWMAPTRDERGRLRADPRRFPGGIRALADYVHSKGLKLGIY
GDVGNRTCAGFPGSYGHYELDAQTFASWGVDLLKFDGCNADSLGLLAEGYRNMSLALNKT
GRPIVYSCEWPFYLRPVQQPNYTEIKQYCNHWRNFYDVYDSWNSIKSIVEWTALHQDSIV
KIAGPGGWNDPDMLVIGNFGLSWDQAVTQMAMWAIMAAPLFMSNDLRHMKPEAKWLLQNK
EVIAINQDPLGQQGYRITKDKNFELWERPLADRAYAVAVLNQQEIGGPQNFTFSLTFLGN
GLACNPACCIQQILPTSRDWGVYNWVSSLSVEVNPTGTVLLKVVPL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gcggcgcgctgggccttggtggccgctgtggcggcggcggcggttgtggcattggataac
ggtgtggcgcggacgccgcccatgggctggctgcactgggagcgcttcctctgcggcacc
gactgcgctgctgagccggacagctgcgtcagcgagcggctgttcaccgagatggccgac
gtgatggtcgcggagggctggaaggaagcgggctacgagttcgtctgcatcgacgactgc
tggatggcgccaacgcgggacgaacgaggccggctgcgggcggatccccggcgcttcccc
ggcggtatccgcgcactggcggactacgtccattccaaagggttgaagctggggatctac
ggtgatgtggggaacaggacgtgtgccggcttccccggcagctatgggcactacgagttg
gacgcacagaccttcgcctcctggggtgtggacttgctgaagtttgatggctgcaacgcc
gactcgctggggctgctggcagaaggttacaggaacatgtctctggccctgaacaagact
ggcagacccatcgtgtactcctgtgaatggcctttctacctgaggcccgtgcagcagccc
aattacacggagatcaaacagtattgcaatcactggaggaacttttatgatgtctatgat
tcttggaacagcatcaagagtattgtggagtggacagcacttcaccaggacagcattgtg
aagatagctgggccagggggctggaatgaccctgacatgttggtgattgggaactttggg
ctgagctgggaccaggcagtgactcagatggcgatgtgggcgatcatggcggcgccgctc
ttcatgtccaatgacctgcggcacatgaaaccagaggccaagtggctgctccagaacaag
gaggtgatcgccatcaaccaggatccgctgggccagcagggctatcgcatcactaaggac
aagaacttcgagctgtgggaacggcccctagctgacagagcctatgctgtggcggtccta
aaccagcaggaaatcgggggaccccagaacttcaccttctccctcaccttcctcggcaat
gggctggcctgcaacccagcgtgctgcatccagcagatcctgccaaccagcagggactgg
ggggtttacaactgggtctcctccctgagtgtagaagtgaacccaacaggcactgtgctg
ttgaaagtagtgccactatag

DBGET integrated database retrieval system