KEGG   Meleagris gallopavo (turkey): 100540687Help
Entry
100540687         CDS       T01523                                 

Definition
alpha-galactosidase A-like
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100540687
  Lipid metabolism
   00561 Glycerolipid metabolism
    100540687
   00600 Sphingolipid metabolism
    100540687
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    100540687
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100540687
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100540687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 268 aa AA seqDB search
AARWALVAAVAAAAVVALDNGVARTPPMGWLHWERFLCGTDCAAEPDSCVSERLFTEMAD
VMVAEGWKEAGYEFVCIDDCWMAPTRDERGRLRADPRRFPGGIRALADYVHSKGLKLGIY
GDVGNRTCAGFPGSYGHYELDAQTFASWGVDLLKFDGCNADSLGLLAEGYRNMSLALNKT
GRPIVYSCEWPFYLRPVQQPNYTEIKQYCNHWRNFYDVYDSWNSIKSIVEWTALHQDSIV
KIAGPGGWNDPDMASRATPIQQQEKILP
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gcggcgcgctgggccttggtggccgctgtggcggcggcggcggttgtggcattggataac
ggtgtggcgcggacgccgcccatgggctggctgcactgggagcgcttcctctgcggcacc
gactgcgctgctgagccggacagctgcgtcagcgagcggctgttcaccgagatggccgac
gtgatggtcgcggagggctggaaggaagcgggctacgagttcgtctgcatcgacgactgc
tggatggcgccaacgcgggacgaacgaggccggctgcgggcggatccccggcgcttcccc
ggcggtatccgcgcactggcggactacgtccattccaaagggttgaagctggggatctac
ggtgatgtggggaacaggacgtgtgccggcttccccggcagctatgggcactacgagttg
gacgcacagaccttcgcctcctggggtgtggacttgctgaagtttgatggctgcaacgcc
gactcgctggggctgctggcagaaggttacaggaacatgtctctggccctgaacaagact
ggcagacccatcgtgtactcctgtgaatggcctttctacctgaggcccgtgcagcagccc
aattacacggagatcaaacagtattgcaatcactggaggaacttttatgatgtctatgat
tcttggaacagcatcaagagtattgtggagtggacagcacttcaccaggacagcattgtg
aagatagctgggccagggggctggaatgaccctgacatggcaagtagagcaacacccatc
cagcagcaggagaaaattcttccttag

  All links  
No link information was found.   
DBGET integrated database retrieval system