KEGG   Meleagris gallopavo (turkey): 100540703Help
Entry
100540703         CDS       T01523                                 

Definition
intestinal-type alkaline phosphatase 1-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100540703
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100540703
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100540703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 530 aa AA seqDB search
MGWLLSPRICFLLLFLAPRTAIATSDAEKTPHYWNEGARRRLEAALALQPVAQRAKNIIL
FMGDGMGLPTVSAARIYKGQLAGGSGEESVLAMETFPHVALAKTYTIDRQVPDSAGTGTA
YLCGVKANAKTLGLSGAAIYGKCRTAFGNEVDSVLHRARLAGKSVGIVTTTRVQHASPAA
AYAHSASRSWYADANMPRETLRDGCKDIAYQLVHNTDINVILGGGRAYMSPRWTPDPEYP
DDPAQNGTRRDGRDLVAEWLSTREGARYVWDKKGLDAVNDTSVSHLMGLFEPKDMKYELN
RNTTTDPSIVEMTEKAIRILRRNPNGFFLFVEGGRIDHGHHSGRAKQALTEAIMLDRAVA
RAGELTEPSDTLTVVTADHSHVFTFGGNTLRGASIFGLAPKKAKDKRTYTSILYGNGPGY
SIRDGGRPAASLPAVEDKDYRQQAAVPLDLETHSGEDVMVLAQGPMAHLFHGVQEQHYIA
HAIAYAACLKPYDARSRCGAPRRASGSTQHSPQLPLTLLALCMSAFMVVG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgggatggctgctctctcccaggatctgcttcctccttcttttcctcgccccgcgcact
gccattgcgacctcagatgccgagaagaccccacactattggaacgaaggggccaggagg
aggctggaggcagccctggccttgcagccagtggcacagcgagccaaaaacatcatcctc
ttcatgggtgatggcatggggctgcccacggtgtcagcagcccggatctacaaggggcaa
ctggccggtggctcgggtgaggagagcgtcttggccatggagacatttccccatgtggcc
ctggccaagacctacaccatcgaccggcaggtgcccgacagcgccggcacgggcacggcc
tacctgtgtggggtgaaggccaatgccaagacgctggggctgagcggcgcggccatctac
ggcaaatgtcgcacagcatttggcaacgaagtggactccgtcctgcaccgggcccggctg
gcaggtaagtcggtgggcatcgtgaccaccacacgggtgcaacatgcatcccctgctgct
gcctatgcacactcggccagccgcagctggtacgccgatgccaacatgcctcgggagacc
ctgcgggatggctgcaaggacatcgcctaccagctggtgcacaacactgacatcaacgtg
atcctgggcggtgggagggcctacatgtctcccaggtggaccccagaccctgagtaccca
gacgacccggcgcagaatggcaccaggagggacgggcgggacctggtggccgaatggctc
agcaccagggagggcgcgcgctatgtctgggacaagaagggcctggatgcggttaatgac
acttctgtgagccacctcatgggcctcttcgagcccaaggacatgaagtacgagctgaac
cgcaacaccaccacggacccctccatcgtggaaatgacagagaaagccatccgcatcctg
cgcaggaaccccaacggcttcttcctttttgtggaaggtggaaggattgaccacggacac
cacagtggccgggccaagcaggcgctgacagaggccatcatgctggaccgggcagtggca
cgggcaggcgagctgacggagccctctgacacactgaccgtggtgacggctgaccactca
catgtcttcacctttgggggcaacacgctgcgaggagcctccatcttcgggttggcccct
aagaaagcgaaggacaagcgaacctataccagcatcctctatggcaatgggccgggatac
agcatccgtgatgggggccgcccagccgccagccttccagctgtggaggacaaggattac
aggcagcaggcagccgtcccccttgacttggagacccacagtggggaggacgtgatggtg
ctggctcagggtcccatggcccacctcttccatggggtgcaggagcagcactacattgcc
catgccattgcttatgctgcgtgcctcaagccttatgatgccagatcccgctgtggtgca
cctcgtagggcctctggcagcacccagcactccccacagcttccactcactctcctggcc
ctctgcatgtctgccttcatggtggtgggctga

DBGET integrated database retrieval system