KEGG   Meleagris gallopavo (turkey): 100540725Help
Entry
100540725         CDS       T01523                                 

Definition
dihydrofolate reductase-like
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100540725
   00670 One carbon pool by folate
    100540725
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     100540725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 67 aa AA seqDB search
AAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLKEYPGVPADVQEENGIQYKFEVY
QKSVLAQ
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
gcagcaatggagaagcccattaatcatcgactgtttgtgacaagaattttgcatgaattt
gaaagcgacacgttttttccagaaattgactacaaagacttcaaacttctcaaagaatac
ccaggtgtccctgcagatgttcaggaagagaatggcatccagtacaaatttgaagtgtat
caaaagtctgtcttggcacaataa

DBGET integrated database retrieval system