KEGG   Meleagris gallopavo (turkey): 100540725Help
Entry
100540725         CDS       T01523                                 

Gene name
DHFR
Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00670  One carbon pool by folate
mgp00790  Folate biosynthesis
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100540725 (DHFR)
   00670 One carbon pool by folate
    100540725 (DHFR)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     100540725 (DHFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 100540725
NCBI-ProteinID: XP_010724401
Ensembl: ENSMGAG00000002698
Position
Z
AA seq 190 aa AA seqDB search
MVRSLNSIVAVCQNMGIGKDGNLPWPPLRNEYKYFQRMTSTSHVEGKQNALIMGKKTWFS
IPEKNRPLKDRINIVLSRELKEAPKGAHYLSKSLDDALALLDSPELKSKVDMVWIVGGTS
VYKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLKEYPGVPADVQEENGIQYKF
EVYQKSVLAQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgctcgctcaattccatcgtggccgtgtgtcagaacatgggcatcgggaaggac
gggaacctgccttggcccccgctaaggaatgagtacaaatacttccagagaatgaccagc
acctcccatgtggaaggtaaacagaatgcactgataatgggtaaaaaaacatggttctcc
attcctgagaagaatcgtcctctgaaagacagaattaatatagtgctcagcagggagctc
aaggaagccccgaaaggagcacattatctttctaaaagcctggatgatgccttagctctt
ttggattcaccagaattaaaaagtaaagtagacatggtttggattgttggaggcacttca
gtatataaggcagcaatggagaagcccattaatcatcgactgtttgtgacaagaattttg
catgaatttgaaagcgacacgttttttccagaaattgactacaaagacttcaaacttctc
aaagaatacccaggtgtccctgcagatgttcaggaagagaatggcatccagtacaaattt
gaagtgtatcaaaagtctgtcttggcacaataa

DBGET integrated database retrieval system