KEGG   Meleagris gallopavo (turkey): 100540725Help
Entry
100540725         CDS       T01523                                 

Definition
dihydrofolate reductase-like
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mgp00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mgp00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 67 aa AA seqDB search
AAMEKPINHRLFVTRILHEFESDTFFPEIDYKDFKLLKEYPGVPADVQEENGIQYKFEVY
QKSVLAQ
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
gcagcaatggagaagcccattaatcatcgactgtttgtgacaagaattttgcatgaattt
gaaagcgacacgttttttccagaaattgactacaaagacttcaaacttctcaaagaatac
ccaggtgtccctgcagatgttcaggaagagaatggcatccagtacaaatttgaagtgtat
caaaagtctgtcttggcacaataa

DBGET integrated database retrieval system