KEGG   Meleagris gallopavo (turkey): 100540750Help
Entry
100540750         CDS       T01523                                 

Gene name
PLCD4
Definition
(RefSeq) phospholipase C delta 4
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100540750 (PLCD4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100540750 (PLCD4)
   04070 Phosphatidylinositol signaling system
    100540750 (PLCD4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100540750 (PLCD4)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100540750 (PLCD4)
Membrane trafficking [BR:mgp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100540750 (PLCD4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100540750 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 735 aa AA seqDB search
MQQGTLMRKVKSKSWKKQRYFKLQDDCMTIWYQSKRTGKIESAFSISDVETVREGHQSEV
LQSLAEEFPPERCFTIVFYGRRGNLDLIAGTEEEAQCWVQGLRQLIEVATSMDQRERIDQ
WIRDWFQKADKNKDGRMNFKEVQRLLKMMNVDMNEDHALRLFQAADKSESGTLEGEEFVL
FYKALTERKEVQSLFQEFSEDGKKLTLLELVDFLRQEQLEEEGTEELAMELIDKYEPSET
ARARHALSADGFLMYLCSPEGSIFNSQHRALWQDMTQPLCHYFISSSHNTYLIEDQIRGQ
SSIEGYIRALKRGCRCLEVDCWDGPNGEPIVYHGHTFTSKIPFREVVSTLGKYAFQASDF
PVILSLENHCSMEQQEVLAQQLKDILGEHLLTTTTDGRVPTQLPSPEELKHKILLKGKKI
GRLEDTLDGPGDEAPDVSDDDNGAEAEEEKRRMKKDRESLAQALSDCVVYCKNVSFRGFQ
EARNHSRPSEISSLSEAKARKLIRDAGNEFVRHNTWQLTRIYPSGMRTDSSNYSPQEMWN
AGCQIVALNFQTAGMEMDLCDGLFSQNGHCGYVLKPSFMRDEGTLFNPSDPSTWQGPGPV
TLTIQVISGQQLPKVANSKDGAIIDPLVRVEIHGVPADQAHQETKYIENNGFNPHWDETL
QFQLQVPQLALVRFVVEDYDKTSRNDFVGQFTLAFANIKPGYRHIHLLSKDGTSIPPSSL
FVHIRITEPPGPEQD
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagggacgctgatgcgtaaagtcaaatccaagagctggaagaagcagaggtac
ttcaagctgcaggatgactgcatgaccatctggtaccagtccaagaggacaggcaagatt
gagtctgctttctccatcagcgatgtggagacagtgcgggaagggcaccagtcagaggtg
ttgcagagcctggctgaggagttcccccctgagcgctgcttcaccattgttttctacggg
cgtcggggcaatctggatctcattgctggcacagaggaagaggcgcagtgctgggtccag
ggcctgcgccagctcattgaagtggccaccagcatggaccagagggagagaatagaccaa
tggattcgtgactggttccagaaagctgacaagaataaggacggacgcatgaacttcaag
gaggtgcagcgtctcctcaagatgatgaacgtagacatgaacgaggaccatgccctgcga
ctcttccaggctgccgacaagtcagagtcagggacgctggaaggggaagagtttgtgctc
ttctacaaagccctcacggagcgcaaggaggtgcagagcctcttccaggagttctctgag
gatgggaagaagctgacgcttctggagctggtggatttcctgcggcaggagcagctggag
gaggagggcacggaggagctcgctatggagctcattgacaaatatgaaccctcagagaca
gccagggctcgccacgcgctgagtgctgatgggttcctcatgtacctctgctccccggag
ggctccatcttcaattctcagcaccgggctctgtggcaggacatgacccagcctctctgc
cactacttcatctcctcctctcacaacacctacttgatagaggaccagatccggggtcag
agcagcatcgaaggctacatcagggctctgaaacggggctgccgctgcctggaggtggat
tgctgggacgggccgaacggggagcctatagtgtaccacggccacaccttcacctccaag
atccccttcagggaggtggtgagcaccctggggaagtacgccttccaggcttccgacttc
ccagtgatcctgtccctggagaaccactgcagcatggagcagcaggaggtgctggcccaa
cagctgaaggacattctgggggagcatctcctcaccaccaccaccgacgggcgcgtcccc
acccagctcccatccccagaggagctgaagcacaagatcctgctgaaggggaagaagatc
gggcggctggaggacacgttggatgggccaggggatgaggcacccgatgtgtctgatgat
gacaatggggcagaggcagaggaggagaagcggaggatgaagaaggacagggagagcctg
gcacaggcgttgtctgactgtgttgtctactgcaagaatgtgtccttccggggtttccag
gaggcccgcaaccactcccggccttctgaaatctcctccctctctgaggcgaaggccagg
aagctcatccgggatgcagggaatgagtttgtccggcacaacacctggcagctgacacgc
atctaccccagtgggatgcggacagactcctccaattatagcccccaggagatgtggaac
gcaggatgtcagattgtggccctgaacttccaaacagctggcatggagatggacctgtgt
gatgggctgttcagccagaatggccactgtggctacgtgcttaaaccatccttcatgaga
gatgaaggaactctcttcaaccctagtgatcctagcacctggcagggccccggccccgtc
accttgacaatccaggtgatcagtgggcagcagctgcccaaagtggccaacagcaaggat
ggagccatcatcgaccccctggtacgtgtggagatccatggggtgcctgcagaccaggca
caccaggagaccaagtacatcgagaacaacgggtttaacccccactgggacgagaccctt
cagttccagcttcaagtgccccagctggcccttgtccgctttgtggtggaggattatgac
aagacctccaggaacgattttgtgggacagttcaccctggcctttgccaacatcaaacct
ggataccgccacatccatctcctctccaaggatggcaccagcatcccgccctcttcgctc
tttgtccacatccgcatcaccgagccgcctggccctgagcaagactga

DBGET integrated database retrieval system