KEGG   Meleagris gallopavo (turkey): 100540750Help
Entry
100540750         CDS       T01523                                 

Gene name
PLCD4
Definition
(RefSeq) phospholipase C, delta 4
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100540750 (PLCD4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100540750 (PLCD4)
   04070 Phosphatidylinositol signaling system
    100540750 (PLCD4)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100540750 (PLCD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 735 aa AA seqDB search
MQQGTLMRKVKSKSWKKQRYFKLQDDCMTIWYQSKRTGKIESAFSISDVETVREGHQSEV
LQSLAEEFPPERCFTIVFYGRRGNLDLIAGTEEEAQCWVQGLRQLIEVATSMDQRERIDQ
WIRDWFQKADKNKDGRMNFKEVQRLLKMMNVDMNEDHALRLFQAADKSESGTLEGEEFVL
FYKALTERKEVQSLFQEFSEDGKKLTLLELVDFLRQEQLEEEGTEELAMELIDKYEPSET
ARARHALSADGFLMYLCSPEGSIFNSQHRALWQDMTQPLCHYFISSSHNTYLIEDQIRGQ
SSIEGYIRALKRGCRCLEVDCWDGPNGEPIVYHGHTFTSKIPFREVVSTLGKYAFQASDF
PVILSLENHCSMEQQEVLAQQLKDILGEHLLTTTTDGRVPTQLPSPEELKHKILLKGKKI
GRLEDTLDGPGDEAPDVSDDDNGAEAEEEKRRMKKDRESLAQALSDCVVYCKNVSFRGFQ
EARNHSRPSEISSLSEAKARKLIRDAGNEFVRHNTWQLTRIYPSGMRTDSSNYSPQEMWN
AGCQIVALNFQTAGMEMDLCDGLFSQNGHCGYVLKPSFMRDEGTLFNPSDPSTWQGPGPV
TLTIQVISGQQLPKVANSKDGAIIDPLVRVEIHGVPADQAHQETKYIENNGFNPHWDETL
QFQLQVPQLALVRFVVEDYDKTSRNDFVGQFTLAFANIKPGYRHIHLLSKDGTSIPPSSL
FVHIRITEPPGPEQD
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagggacgctgatgcgtaaagtcaaatccaagagctggaagaagcagaggtac
ttcaagctgcaggatgactgcatgaccatctggtaccagtccaagaggacaggcaagatt
gagtctgctttctccatcagcgatgtggagacagtgcgggaagggcaccagtcagaggtg
ttgcagagcctggctgaggagttcccccctgagcgctgcttcaccattgttttctacggg
cgtcggggcaatctggatctcattgctggcacagaggaagaggcgcagtgctgggtccag
ggcctgcgccagctcattgaagtggccaccagcatggaccagagggagagaatagaccaa
tggattcgtgactggttccagaaagctgacaagaataaggacggacgcatgaacttcaag
gaggtgcagcgtctcctcaagatgatgaacgtagacatgaacgaggaccatgccctgcga
ctcttccaggctgccgacaagtcagagtcagggacgctggaaggggaagagtttgtgctc
ttctacaaagccctcacggagcgcaaggaggtgcagagcctcttccaggagttctctgag
gatgggaagaagctgacgcttctggagctggtggatttcctgcggcaggagcagctggag
gaggagggcacggaggagctcgctatggagctcattgacaaatatgaaccctcagagaca
gccagggctcgccacgcgctgagtgctgatgggttcctcatgtacctctgctccccggag
ggctccatcttcaattctcagcaccgggctctgtggcaggacatgacccagcctctctgc
cactacttcatctcctcctctcacaacacctacttgatagaggaccagatccggggtcag
agcagcatcgaaggctacatcagggctctgaaacggggctgccgctgcctggaggtggat
tgctgggacgggccgaacggggagcctatagtgtaccacggccacaccttcacctccaag
atccccttcagggaggtggtgagcaccctggggaagtacgccttccaggcttccgacttc
ccagtgatcctgtccctggagaaccactgcagcatggagcagcaggaggtgctggcccaa
cagctgaaggacattctgggggagcatctcctcaccaccaccaccgacgggcgcgtcccc
acccagctcccatccccagaggagctgaagcacaagatcctgctgaaggggaagaagatc
gggcggctggaggacacgttggatgggccaggggatgaggcacccgatgtgtctgatgat
gacaatggggcagaggcagaggaggagaagcggaggatgaagaaggacagggagagcctg
gcacaggcgttgtctgactgtgttgtctactgcaagaatgtgtccttccggggtttccag
gaggcccgcaaccactcccggccttctgaaatctcctccctctctgaggcgaaggccagg
aagctcatccgggatgcagggaatgagtttgtccggcacaacacctggcagctgacacgc
atctaccccagtgggatgcggacagactcctccaattatagcccccaggagatgtggaac
gcaggatgtcagattgtggccctgaacttccaaacagctggcatggagatggacctgtgt
gatgggctgttcagccagaatggccactgtggctacgtgcttaaaccatccttcatgaga
gatgaaggaactctcttcaaccctagtgatcctagcacctggcagggccccggccccgtc
accttgacaatccaggtgatcagtgggcagcagctgcccaaagtggccaacagcaaggat
ggagccatcatcgaccccctggtacgtgtggagatccatggggtgcctgcagaccaggca
caccaggagaccaagtacatcgagaacaacgggtttaacccccactgggacgagaccctt
cagttccagcttcaagtgccccagctggcccttgtccgctttgtggtggaggattatgac
aagacctccaggaacgattttgtgggacagttcaccctggcctttgccaacatcaaacct
ggataccgccacatccatctcctctccaaggatggcaccagcatcccgccctcttcgctc
tttgtccacatccgcatcaccgagccgcctggccctgagcaagactga

DBGET integrated database retrieval system