KEGG   Meleagris gallopavo (turkey): 100540770Help
Entry
100540770         CDS       T01523                                 

Definition
serine/threonine-protein kinase 6-B-like
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Oocyte meiosis
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:mgp04114]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 344 aa AA seqDB search
MDKKIKENCPGNPSRPAKVANPVVDGPKRVPVPQNSAQSRPLNSGVQPQRVLCPSNFAQR
VPVQSQKSSSLSNQKLSNSQTTQQPRLKLPVQPTAGPQVPSKNNEKSQQAPVAGNSEDDI
FMCWDTWDTSNKSAVQKTHPNILRLYGYFHDVTRVYLILEYAPRGEVFKELQKLTKFDEQ
RTATYITELADALSYCHSKNVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRSTLCG
TLDYLPPEMIEGRTHDEKVDIWSLGVLCYEFLVGKPPFEAETYQETYRAISRVEFKYPLF
VTEGARDLISKLLKHNPFHRLPLKDVLVHPWITANSTKLPNDRK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaagataaaagaaaactgtcctggaaacccttctcgccctgctaaggtagca
aatcctgttgtagatggcccaaagcgtgtccctgtgcctcagaattctgcccagagccgg
ccactgaacagtggagttcaaccacagcgtgttctgtgtccttcaaattttgcccagcga
gttcctgtacaatcacaaaaatcttcttcactgtcaaaccaaaaactgtctaacagtcag
acaacacagcagccccgactgaaactcccagtccagccaactgctgggcctcaggttcca
agcaagaacaatgaaaaatctcaacaagctcctgtagctggtaattctgaagatgatatc
tttatgtgttgggacacttgggatacttcaaacaagagtgcagtacagaaaacgcatccc
aacatcctcagactatacggctacttccatgacgttacaagagtctaccttattctagag
tatgcacctcgtggagaagtcttcaaggaactacagaagcttaccaaattcgatgaacaa
agaactgcaacttacattacagagctagcagatgccctatcatactgtcattcaaagaat
gtgattcaccgggacatcaagccagaaaacctgctgcttggctcaaatggagaattaaaa
attgcagactttgggtggtctgtacatgctccatcctctaggagatcaactctctgtggg
acacttgactacttgcctcctgaaatgattgagggaagaacacatgatgaaaaggtggat
atttggagcttgggggttctgtgctatgaattccttgtaggaaagccaccttttgaagca
gaaacatatcaagaaacctacagagctatttccagggtggaattcaagtatccattattt
gtaacagaaggtgcaagggatttaatttcaaagcttctgaaacataacccattccatcgg
ctgcccttgaaggatgtacttgttcatccctggattacagcaaattctacaaagctgccc
aacgatagaaaatga

DBGET integrated database retrieval system