KEGG   Meleagris gallopavo (turkey): 100540770Help
Entry
100540770         CDS       T01523                                 

Gene name
AURKA
Definition
(RefSeq) aurora kinase A
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100540770 (AURKA)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100540770 (AURKA)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   100540770 (AURKA)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100540770 (AURKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 408 aa AA seqDB search
MDKKIKENCPGNPSRPAKVANPVVDGPKRVPVPQNSAQSRPLNSGVQPQRVLCPSNFAQR
VPVQSQKSSSLSNQKLSNSQTTQQPRLKLPVQPTAGPQVPSKNNEKSQQAPVAAKSSEAD
STSKQKNEEATKKKETKKRQWSLDDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKA
QLEDAGVEHQLRREVEIQSHLRHPNILRLYGYFHDVTRVYLILEYAPRGEVFKELQKLTK
FDEQRTATYITELADALSYCHSKNVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRS
TLCGTLDYLPPEMIEGRTHDEKVDIWSLGVLCYEFLVGKPPFEAETYQETYRAISRVEFK
YPLFVTEGARDLISKLLKHNPFHRLPLKDVLVHPWITANSTKLPNDRK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaagataaaagaaaactgtcctggaaacccttctcgccctgctaaggtagca
aatcctgttgtagatggcccaaagcgtgtccctgtgcctcagaattctgcccagagccgg
ccactgaacagtggagttcaaccacagcgtgttctgtgtccttcaaattttgcccagcga
gttcctgtacaatcacaaaaatcttcttcactgtcaaaccaaaaactgtctaacagtcag
acaacacagcagccccgactgaaactcccagtccagccaactgctgggcctcaggttcca
agcaagaacaatgaaaaatctcaacaagctcctgtagctgcaaagagttctgaagcagac
agcacctctaaacagaaaaatgaagaggctactaaaaagaaagaaactaaaaaaagacag
tggtctcttgatgattttgaaattggtcgacctctggggaaaggaaaatttggaaatgtg
tacttggcacgtgaaaagcagagcaaatttattcttgcactgaaggtgctgtttaaagca
cagcttgaggatgctggtgtagaacatcaactacgaagagaagttgaaatacagtctcat
ctcaggcatcccaacatcctcagactatacggctacttccatgacgttacaagagtctac
cttattctagagtatgcacctcgtggagaagtcttcaaggaactacagaagcttaccaaa
ttcgatgaacaaagaactgcaacttacattacagagctagcagatgccctatcatactgt
cattcaaagaatgtgattcaccgggacatcaagccagaaaacctgctgcttggctcaaat
ggagaattaaaaattgcagactttgggtggtctgtacatgctccatcctctaggagatca
actctctgtgggacgcttgactacttgcctcctgaaatgattgagggaagaacacatgat
gaaaaggtggatatttggagcttgggggttctgtgctatgaattccttgtaggaaagcca
ccttttgaagcagaaacatatcaagaaacctacagagctatttccagggtggaattcaag
tatccattatttgtaacagaaggtgcaagggatttaatttcaaagcttctgaaacataac
ccattccatcggctgcccttgaaggatgtacttgttcatccctggattacagcaaattct
acaaagctgcccaacgatagaaaatga

DBGET integrated database retrieval system