KEGG   Meleagris gallopavo (turkey): 100540815Help
Entry
100540815         CDS       T01523                                 

Definition
agmatinase, mitochondrial-like
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mgp00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
23
AA seq 333 aa AA seqDB search
MSCLLRTARLSARWLFASAAAPCRRASRFNVPPSAEFVARPVGVCSMLRLPVQTSAEGLN
AAFVGVPLDAGTSNRPGARFGPQQIRAESVMVRRYNASTGAAPFDSLLVADVGDVNVNLY
NLPNSCRRIYESYQKIVASGCVPLTLGGDHTVTYPILQAVAEKHGPVGLVHVDAHTDTSD
MALGEKIYHGTPFRRCVDEGLLDCSRVVQIGIRGSSYAPDPYKYCWDQGFRVVPAEECWM
KSLVPLMGEVRQQMGDGPVYISFDIDGLDPAYAPGTGTPEIAGLTPMQALEIIRGCKGLN
IVGCDLVEVAPIYDVSGELMEICGAAGLKGHMH
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtctgctcaggacagccaggctctctgctcggtggctttttgcatctgctgct
gctccatgccgccgtgcctcgcggttcaacgtgcctcccagtgctgagttcgtggcccgg
cccgtaggggtctgctccatgctgaggcttcctgttcagacctcagcagaggggctgaat
gcagcttttgtcggcgttccccttgacgcgggcacatccaaccggcccggagccaggttt
ggtcctcagcagatccgtgctgagtcagtgatggtgaggaggtacaacgccagcactggg
gcagcgcctttcgactccctgctggtggctgatgttggagatgtgaacgtcaacctctac
aacctgcccaacagctgccgccgcatctacgagtcctaccaaaagatcgtggcctctggc
tgtgtgcctctcactctgggtggagaccacactgtaacataccccatcctgcaggcagtg
gcagaaaagcatggacctgtggggctggtgcacgtggatgctcacactgacaccagtgac
atggccctgggggagaagatctaccatgggaccccgttccggcgctgcgtggatgaaggg
ctgctggactgcagccgtgtggttcagattggcatccgtggctcctcctatgcccccgat
ccgtacaagtactgctgggaccagggattccgggtggttccagctgaggagtgctggatg
aagtccctggttccactgatgggagaggtgaggcagcagatgggggatggcccggtgtac
atcagctttgatatcgacgggctggaccctgcctatgccccgggaacagggacaccagag
attgctgggctcacacctatgcaggctttggagattattcgtggttgtaaaggactcaat
atagtgggatgtgaccttgtggaggtggcacccatatatgatgtctctggtgagttgatg
gaaatctgtggggctgcagggctgaaagggcacatgcactga

DBGET integrated database retrieval system