KEGG   Meleagris gallopavo (turkey): 100540890Help
Entry
100540890         CDS       T01523                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 1-like
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100540890
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100540890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 189 aa AA seqDB search
MVYPASLATESILYIYLCNRFSFLVHYRALIFPFLIRQGKPTPFFTFLLALLFCIYNGYL
QGRSLSTYAEYPSDWLKRPCFIAGFMGWLIGMAINIHSDHILRNLRKPGETGYKIPRGGM
FEYVSGANFFGEILEWFGFSLACCTIESLAFALCTLFILGSRAKQHHQWYLEKLEDYPKN
RKIVIPFVY
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggtttatcctgcaagtctggccactgaaagcatcctttatatttatttatgcaacaga
ttttctttccttgttcattatagggcactcatatttccttttctgatccggcaaggaaag
ccgacaccgtttttcaccttcctactagcacttctcttctgtatatacaatggatacctg
caaggccgaagcttaagcacctatgcagagtacccttcagattggttaaaacgtccttgt
ttcattgcaggtttcatggggtggctgatcggcatggcaatcaatattcattctgatcat
atccttagaaatctgagaaaacctggagaaactggttacaagataccaagaggaggaatg
tttgaatatgtcagcggagccaacttctttggagagatcctggaatggtttggattttct
cttgcctgctgcactattgaaagccttgcatttgcactgtgtactcttttcattttgggt
tcaagggcaaagcaacaccaccaatggtaccttgagaaacttgaagactacccaaagaac
agaaaaattgtgattccatttgtgtattag

DBGET integrated database retrieval system