KEGG   Meleagris gallopavo (turkey): 100540952Help
Entry
100540952         CDS       T01523                                 

Gene name
UCHL5
Definition
(RefSeq) ubiquitin C-terminal hydrolase L5
  KO
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100540952 (UCHL5)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100540952 (UCHL5)
Ubiquitin system [BR:mgp04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    100540952 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 319 aa AA seqDB search
MESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQ
DSRLDTIFFAKQVINNACATQAIVSVLLNCAHQDIRLGETLSEFKEFSQSFDAAMKGLAL
SNSEVIRQVHNSFARQQMFEFDAKSSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGS
CNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQRIAELQRQLAEEEPMDT
DQSSNMLSSIQSEVAKYQMLIEEENQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLI
PLVEKAKEKQNAKKVQEAK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggagagcgacccgggcgtcttcaccgaactcatcaagggcttcggctgcagaggagca
caagtagaagaaatatggagtttagaaccagaaaacttcgaaaaattgaagccagtgcat
gggctgatattccttttcaagtggcagccaggagaggaaccagcaggttctgttgttcaa
gattccaggctggatacaatattttttgctaaacaggtgataaataatgcttgtgctact
caagccatagtaagcgtgttgttaaattgtgctcatcaggatatccgtctaggagagact
ttgtcagaatttaaagaattttcacagagttttgatgctgcgatgaaaggcttggcacta
agcaactccgaagtgattcgacaagttcacaacagctttgccagacagcagatgtttgaa
tttgatgcaaagtcttcagcaaaagaagaagatgcatttcactttgtaagctacgttcct
gttaatggacggctgtatgagctggatggattaagggaaggaccaattgatttaggttca
tgcaatcaagatgactggataagtgctgtgagacctgtcatagagaaacggatacaaaaa
tacagcgaaggtgagataaggtttaatttgatggctattgtatctgacagaaagatgata
tatgaacagagaattgcagaactacagcgacaacttgcagaggaggaacctatggataca
gatcaaagtagtaacatgttaagttctatacagtcagaagttgcaaaatatcagatgtta
atcgaagaagaaaaccaaaaactaaaaagatacaagattgaaaacattagaagaaaacat
aactacctgcctttcatcatggaattattaaagactctagcagaacatcaacagttaata
ccattagtagaaaaagctaaagaaaaacagaacgccaagaaagttcaggaggccaagtga

DBGET integrated database retrieval system