KEGG   Meleagris gallopavo (turkey): 100541003Help
Entry
100541003         CDS       T01523                                 

Definition
aspartyl-tRNA synthetase, cytoplasmic-like
Orthology
K01876  
aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    100541003
Enzymes [BR:mgp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     100541003
Amino acid related enzymes [BR:mgp01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   100541003
Transfer RNA biogenesis [BR:mgp03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100541003
 Prokaryotic Type
   Other AARSs
    100541003
Mitochondrial biogenesis [BR:mgp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    100541003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 476 aa AA seqDB search
MPSAAGRGQGKDRRPDNEEQPAADDYAKERYGVSSMIQSQEKPDRVLVRIKDLSEEKADE
VVWVRGRVHTSRAKGKQCFLVLRQQQFNIQALVAVGQHASKQMVKFAANINKESIVDVEG
VVRKAHQKIGGCTQQDVELHVQRIYVISLAEPRLPLQLDDAVRPEVEGEEDGRATVNQDT
RLDNRVIDLRTSTSQAVFCLQSGICQLFRETLIRKGFVEIQTPKIISAASEGGANVFTVS
YFKSSAYLAQSPQLYKQMCICADFEKVFCVGPVFRAEDSNTHRHLTEFVGLDIEMAFNYH
YHEVVDEIADTLVQIFKGLQERFQTEIQMVNKQFPCEPFKFLEPTLRLEYREAVAMLREA
GVEMGDEEDLSTPNEKLLGRLVKEKKNSNSYDMFMRGEEILSGAQRIHDPQLLTERAKHH
GIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLYLGLHNVRQTSMFPRDPKRLTP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcgccgcgggtcgcggccagggcaaggaccgccgcccggacaacgaagagcag
ccggcggccgatgattatgcgaaagaaagatatggagtgtcatcaatgatacaatcccaa
gagaaaccagatcgtgttttagttcgaataaaagacctgtcagaggagaaggctgatgag
gtggtttgggttcgtggcagagttcatacaagcagagctaaagggaagcagtgtttctta
gtcctgcgtcagcagcagtttaatatccaggctcttgtggctgtgggacagcatgcaagc
aagcagatggtaaagtttgctgccaacatcaacaaagagagcattgtggatgtagaaggc
gttgtgaggaaagcacatcagaaaatcggaggttgtactcagcaagatgttgagctgcat
gttcaaaggatctatgtgatcagtttagctgaaccccgactccctttacagctggatgat
gctgttcggccagaagtggaaggcgaggaggatggaagagctactgtaaaccaagataca
agactggacaacagagtcattgatctgaggacttccaccagtcaggcagtcttctgcctt
cagtctggtatttgtcagctttttagagaaactctcattcgcaagggatttgtggaaatt
cagactcccaaaatcatttcagctgctagcgaaggaggagccaatgtgtttactgtatca
tacttcaaaagcagcgcctacctggctcaatccccacagctatacaagcagatgtgtata
tgtgctgactttgaaaaagttttttgtgttggaccagtttttagagctgaggactccaat
acacacagacacctgactgagtttgttggtctggatattgaaatggcttttaactaccac
tatcatgaagtggtagatgagattgcagacaccttggtgcagatattcaagggacttcag
gagagattccaaactgaaattcagatggtgaacaaacagttcccatgtgagccatttaag
tttttggagccaactctgaggctggaataccgtgaagctgtggccatgcttagggaggca
ggcgttgagatgggggatgaagaagatctgagcacacctaatgaaaagctcctggggcgt
ctggtaaaggaaaagaaaaactccaactcctatgatatgttcatgagaggggaagagatt
ttgtctggagctcagagaattcacgaccctcagctgctgacagaaagagcgaagcatcat
ggcattgatttggagaaaataaaggcttatatcgattcctttcggtttggtgcacctcca
catgctggtggtggaatagggctggaaagagtaactatgctatacctagggttgcataat
gttcgtcagacctccatgttcccacgggatcccaagcgactgacaccctaa

DBGET integrated database retrieval system