KEGG   Meleagris gallopavo (turkey): 100541003Help
Entry
100541003         CDS       T01523                                 

Definition
aspartyl-tRNA synthetase, cytoplasmic-like
Orthology
K01876  
aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Aminoacyl-tRNA biosynthesis
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:mgp00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 476 aa AA seqDB search
MPSAAGRGQGKDRRPDNEEQPAADDYAKERYGVSSMIQSQEKPDRVLVRIKDLSEEKADE
VVWVRGRVHTSRAKGKQCFLVLRQQQFNIQALVAVGQHASKQMVKFAANINKESIVDVEG
VVRKAHQKIGGCTQQDVELHVQRIYVISLAEPRLPLQLDDAVRPEVEGEEDGRATVNQDT
RLDNRVIDLRTSTSQAVFCLQSGICQLFRETLIRKGFVEIQTPKIISAASEGGANVFTVS
YFKSSAYLAQSPQLYKQMCICADFEKVFCVGPVFRAEDSNTHRHLTEFVGLDIEMAFNYH
YHEVVDEIADTLVQIFKGLQERFQTEIQMVNKQFPCEPFKFLEPTLRLEYREAVAMLREA
GVEMGDEEDLSTPNEKLLGRLVKEKKNSNSYDMFMRGEEILSGAQRIHDPQLLTERAKHH
GIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLYLGLHNVRQTSMFPRDPKRLTP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcgccgcgggtcgcggccagggcaaggaccgccgcccggacaacgaagagcag
ccggcggccgatgattatgcgaaagaaagatatggagtgtcatcaatgatacaatcccaa
gagaaaccagatcgtgttttagttcgaataaaagacctgtcagaggagaaggctgatgag
gtggtttgggttcgtggcagagttcatacaagcagagctaaagggaagcagtgtttctta
gtcctgcgtcagcagcagtttaatatccaggctcttgtggctgtgggacagcatgcaagc
aagcagatggtaaagtttgctgccaacatcaacaaagagagcattgtggatgtagaaggc
gttgtgaggaaagcacatcagaaaatcggaggttgtactcagcaagatgttgagctgcat
gttcaaaggatctatgtgatcagtttagctgaaccccgactccctttacagctggatgat
gctgttcggccagaagtggaaggcgaggaggatggaagagctactgtaaaccaagataca
agactggacaacagagtcattgatctgaggacttccaccagtcaggcagtcttctgcctt
cagtctggtatttgtcagctttttagagaaactctcattcgcaagggatttgtggaaatt
cagactcccaaaatcatttcagctgctagcgaaggaggagccaatgtgtttactgtatca
tacttcaaaagcagcgcctacctggctcaatccccacagctatacaagcagatgtgtata
tgtgctgactttgaaaaagttttttgtgttggaccagtttttagagctgaggactccaat
acacacagacacctgactgagtttgttggtctggatattgaaatggcttttaactaccac
tatcatgaagtggtagatgagattgcagacaccttggtgcagatattcaagggacttcag
gagagattccaaactgaaattcagatggtgaacaaacagttcccatgtgagccatttaag
tttttggagccaactctgaggctggaataccgtgaagctgtggccatgcttagggaggca
ggcgttgagatgggggatgaagaagatctgagcacacctaatgaaaagctcctggggcgt
ctggtaaaggaaaagaaaaactccaactcctatgatatgttcatgagaggggaagagatt
ttgtctggagctcagagaattcacgaccctcagctgctgacagaaagagcgaagcatcat
ggcattgatttggagaaaataaaggcttatatcgattcctttcggtttggtgcacctcca
catgctggtggtggaatagggctggaaagagtaactatgctatacctagggttgcataat
gttcgtcagacctccatgttcccacgggatcccaagcgactgacaccctaa

DBGET integrated database retrieval system