KEGG   Meleagris gallopavo (turkey): 100541011Help
Entry
100541011         CDS       T01523                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Influenza A
Herpes simplex infection
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100541011 (MAPK9)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100541011 (MAPK9)
   04012 ErbB signaling pathway
    100541011 (MAPK9)
   04310 Wnt signaling pathway
    100541011 (MAPK9)
   04068 FoxO signaling pathway
    100541011 (MAPK9)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100541011 (MAPK9)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100541011 (MAPK9)
   04621 NOD-like receptor signaling pathway
    100541011 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    100541011 (MAPK9)
  Endocrine system
   04910 Insulin signaling pathway
    100541011 (MAPK9)
   04920 Adipocytokine signaling pathway
    100541011 (MAPK9)
   04912 GnRH signaling pathway
    100541011 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    100541011 (MAPK9)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100541011 (MAPK9)
  Infectious diseases
   05132 Salmonella infection
    100541011 (MAPK9)
   05164 Influenza A
    100541011 (MAPK9)
   05168 Herpes simplex infection
    100541011 (MAPK9)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100541011 (MAPK9)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100541011 (MAPK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
15
AA seq 424 aa AA seqDB search
MSESKSDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESDRDKLKTSQARDLLSK
MLVVDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVNSNTSPSQSSSINDISSMSTEQTLASDTDSSLDALTGPL
EGCR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagtaaatctgatagtcagttttacagtgttcaagttgcagattcaacattc
actgtactaaaacgttaccagcaattgaagcctataggatcaggggcacagggcattgtt
tgtgctgcgttcgatacggtccttggaataaacgttgctgtaaagaagttgagccgtcct
tttcagaatcaaacccacgcgaaaagagcttacagagagcttgttcttttaaaatgtgtc
aatcacaaaaatataattagcttattaaatgtatttacaccgcagaagtcactagaggaa
tttcaggatgtatatttggttatggagctgatggatgccaacttgtgccaagttattcat
atggaattggatcatgaaagaatgtcttatctcctttaccagatgctatgtggtatcaaa
catctccactcagctggtatcatccacagagatttgaaacccagcaacatagtagtaaaa
tcagattgtacactcaaaatccttgattttggactggcaagaacagcgtgtactaatttt
atgatgactccatatgtagtaacacgatattacagagcgccagaggttatccttggaatg
ggatataaagagaatgttgatatctggtcagttggttgcatcatgggagaattggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcaatggaataaagtaattgaacaa
ctaggaacgccctcagcagaattcatgaagaaactacagcctacagtgaggaattatgta
gaaaacaggccaaaatatccaggtattaaatttgaagagctctttccagactggatattt
ccatcagaatcagaccgtgacaagttaaaaaccagtcaagctagagatttattatcaaaa
atgcttgtagtagatccagacaagagaatttccgtagatgaggccttacgtcatccctat
attactgtctggtatgatccagctgaagcagaagctcctccacctcaaatttacgatgca
caactggaggagagagaacacgcaattgaagaatggaaagaattaatatacaaagaggta
atggattgggaagaaagaagcaagaatggtgtggtaaaagaccagccctcagatgcagca
gtgaatagcaacaccagtccttcccagtcatcatctatcaatgacatttcatccatgtca
acagagcaaacattggcttcagatacagacagcagcctcgatgccttgacaggacccctc
gaaggatgccgatga

DBGET integrated database retrieval system