KEGG   Meleagris gallopavo (turkey): 100541053Help
Entry
100541053         CDS       T01523                                 

Gene name
USP37
Definition
ubiquitin specific peptidase 37
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100541053 (USP37)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100541053 (USP37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 998 aa AA seqDB search
MAPLKVHGPVRMRSMQTGITKWKEGSFEIVEKDNKVSLVVHYNVGGIPKTFQLSHNIKSV
TLRPNGRKLCCLMLTLKDTSFLTIDKVPLKDANEMRMYLDAVHQDRLHTAGKPSQGSGSF
GGVLGSRTTQKEANRQFSYIENQAPSKRVTVESKDENPFRKVLGTPARASIKNSSGTGAP
GNRGNVAASPTSAVPHRTGLLESREKRKRAQPPSSEMSEDYPKENDSSTNNIAMSDPTWK
YLNSSREKQLKLKQEEENRTSGVLPLQSSSFYGSRSSSKEYSTSSSTLDRSSVSSQTTSA
KRSLGFLSQPAPLSVKKMRSNQDYTGWNKPRVPLSTHPQQQLQGFSNLGNTCYMNAILQS
LFSIQSFANDLLKQGIPWKKIPLNALIRRFAHLLAKKDVSSPEVKKELLKKVKSAISATA
ERFSGYMQNDAHEFLSQCLDQLKEDMEKLNKTWKSEPVPNDDSSPGRASDDLSATKVYTC
PVISNLEFEVQHSIICKTCGETVTKREQFNDLSIDLPRRKKLFPSRSIQDSLDLFFRAEE
IEYSCEKCNGKSAVVTHKFNRLPRVLILHLKRYSFNVALSLNHKVGQQVVIPRYLTLLSH
CTESTRLPLTLGWSAHSAVSRPLKASQMVNSCTISTSTPCRKYTFKSKSSASLCVDSDSD
DEPLKRSVANSQRLCNIQSRDQQQLQEEPEKSSKRSKMEGDKPELGNAGFDGMSEDELLA
AVLEISKREASLSLSHDEDKPTSSPDTGFGDDEIQELPENLETMETEKPKAPLESGPANF
TEITKDFDENKENKTPEGSQGEVDWLQQYDMEREREEQELQQALAQSLQEQEAREQKEDD
DLKRATELSLQEFNSSLLDSVGSDEDSGNEDVLDMEYSEAEAEELKRNAEFLLSYNSSPI
FLNQEVRFKALPVNCISQVSWSESHYISDVYDIKKQSWFTYNDLEVSRTLETTVQCDRDR
SGYIFFYMHKDIFDELLETEKSAQPLSTEVGRSIRQPL
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atggccccgctgaaagtgcacggccccgtgcggatgcgcagcatgcagaccggcatcacc
aagtggaaggagggcagcttcgagatcgtggagaaggacaacaaagtcagcctggtggtc
cactacaacgtggggggcatccccaagaccttccagctaagccataacattaagtctgtg
accttacggcccaatggcagaaagctgtgctgcctgatgctgacgctgaaggataccagc
ttcctgaccattgataaggtaccgcttaaagacgcgaatgagatgcggatgtatttggat
gcggtccatcaagacaggcttcatactgctgggaaaccctctcagggatctggcagcttt
ggaggtgtgctgggcagcaggaccacacagaaggaagctaataggcaattctcttatata
gagaatcaggctccttccaaaagggtgactgtggaaagtaaggatgaaaatccatttcgc
aaggtgctgggcaccccagctcgggcatccattaagaactccagtggaactggagcacct
ggcaacagggggaatgttgcagcatctccaacatcggcagtccctcacagaacaggcttg
ctggagagccgtgaaaagaggaaaagagcacaacctccaagttcagaaatgagtgaagat
tatcccaaagagaatgattcttcgacgaataatatagctatgagtgatccaacatggaaa
tacttaaacagtagcagagagaaacagttaaaactgaagcaagaggaagaaaataggacg
tcaggtgttttaccgttgcagtcatcatccttttatgggagtaggtcctcatcaaaagag
tactccactagcagttccaccctggacaggtctagtgtatccagccagactacttcagcc
aaaagaagcctgggatttctttctcaacctgcccctctttctgttaaaaaaatgagatct
aatcaagattacacagggtggaacaaaccccgagtgcccctttccacccaccctcagcag
caattacaagggttttctaacttaggaaacacctgctatatgaatgccattctacagtcc
ttgttttcaatccagtcctttgctaatgatttgctcaagcagggcatcccatggaagaaa
attccactcaatgcgcttatcaggcgttttgcccatctcttagcgaaaaaggatgtcagc
agccctgaggttaagaaagagttgctcaagaaggtgaaaagtgccatctcagctactgca
gagagattctctgggtatatgcagaatgatgcacatgagttcttgagccagtgtctggac
cagctgaaagaggacatggaaaagttgaacaagacttggaagagtgaaccagtccctaat
gatgatagctcacctggacgggcttctgatgatctttcagctaccaaagtttatacttgc
ccagttatcagtaacttagagtttgaggttcagcattctatcatttgtaaaacatgtggt
gaaacagtcaccaaacgggagcagttcaatgacctctccattgaccttcctcgaagaaag
aagttgtttccatctcggtcgatccaggattcccttgacctcttctttcgggcggaggaa
attgagtattcctgtgagaaatgtaatgggaagtctgctgttgtcacacacaaattcaat
cggcttcccagggtcctgattcttcatctgaaacgatacagcttcaacgtagcattgtct
ctcaatcataaagttgggcaacaggtggttattccgagatacttaaccctgctttcacac
tgtacagaaagcaccaggctgccactgacgctgggctggagtgcccattctgcagtttcc
cgtccgctgaaagcctcccagatggtgaattcctgtactataagcacttctacgccttgt
agaaagtatactttcaaatcaaagagctctgcatcgctctgtgtggattcggacagcgat
gatgagcccctgaaacgctctgttgccaatagccaaaggttgtgcaacatacagagtaga
gatcagcaacaactgcaagaagagccagaaaagagttcaaaaagaagtaaaatggagggc
gataaacctgagctgggcaatgctggttttgatgggatgagcgaagatgagctgctagca
gctgtcttagaaatcagcaaaagggaagcttctctgtctctgagccatgatgaggataag
cccacaagcagcccagacactgggtttggagatgatgaaattcaggagttgcctgaaaac
ctggaaacgatggagacagagaaacccaaagcacccttagaatcaggtcctgccaatttc
actgagataactaaagatttcgatgagaataaggaaaacaaaactccggaaggctcccag
ggagaggttgactggctgcagcagtatgatatggagagagagagggaagaacaagaactt
cagcaagcactggctcagagccttcaagaacaagaggcacgagaacaaaaagaggatgat
gaccttaagcgagctacggaattaagtctacaagagtttaacagctctctcctggacagc
gttggctctgatgaggactctgggaatgaggatgtgcttgacatggagtactcagaagct
gaagcagaagagctgaaaagaaacgctgagttcttactttcttacaattcttcaccaatt
ttcttaaaccaagaagtgcgttttaaagcgttgccagtgaactgcatcagtcaagtatcc
tggtctgagagtcactatatcagcgatgtctatgatatcaagaagcagtcctggttcacc
tacaatgatctggaggtgtctagaactctagaaaccactgtccagtgtgacagagaccga
agtggctacatcttcttctatatgcacaaggatatcttcgatgaattactagagacagaa
aaaagtgcacagccacttagcacagaagtaggcagatcgatccgtcagccgctgtga

DBGET integrated database retrieval system