KEGG   Meleagris gallopavo (turkey): 100541071Help
Entry
100541071         CDS       T01523                                 

Definition
nuclear receptor coactivator 3-like
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100541071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
22
AA seq 1264 aa AA seqDB search
MSGLGENSLDSLTSESRKRKPLPCDTPGASLTCSGEKRRREQESKYIEELAELISANLSD
IDNFNVKPDKCAILKETVRQIRQIKEQGKAVSNDDDVQKADVSSTGQGVIDKDSLGPLLL
QALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYGILHEEDRKDFLKNLPKSSV
NGVAWTNDTPRQKSHTFNCRMMVKTSHDLLEDVGSHQDTRQRYETMQCFALSQPRAIMEE
GEEQNGYRPNPNAVGQNIRTTVAGNTNSVGLMNMSPGQGMPMQNRNYGMGDPNTVGQLSS
SRYGGPGNMGPVNSGPGMQSSAYQSNSYGLNISSPPHGSPGLTSNQQNLMISTRNRGSPK
MNSHQFSPVTGMHSPMGSASNTSNSTFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDSS
PNVSIAQQNKANNQDSKSPSGLYCEQNQVESSICQSNSRDVLSEKDSKEGSLDAPESQRG
QSESKGHKKLLQLLTCSSDERGHSTASNSPLDSNCKESSTNVTSPSGVSSSTSGGVSSSS
NVHGSLLQEKHRILHKLLQNGNSPAEVAKITSGHPLAACNQRQSCCKLVNIDTNSLRSSM
RPGFEDTIRRCIQRFLCHNDGQSWSNKRHYHEAYTQGHAETPLYRFSLADGTIVTAQTKS
KVFRNPVTNDRHGFMSGDLDNLDAILGDLTSSDFYNNAMSTSGNSFGTKQALFQGNAPLS
MRSPQSVQTTRPPFNRAMSLDSPVGSGASVRNVNAFSMLQKQNLMGGSPRMAENQESFGA
NIGDWGLPNSKVNRLEPTSSTSMLRQGAEFSASLPRPTAGGSMPGLPIRSNSIPGTRPML
QQQMMHMRSNEINIGMGGNPYGQPGPASQPGSWPDNMLSMEQASRGLQNRQLVRNSLDDL
LSAAPSVEGQNDERALLDQLHTLLSNTDVTSLEEIDRALGIPDLVNQGQTLEPKQDSFQG
QESAVMIDQKPSLYGQPYQGQGTALPGGFNNIQGQQPSFNSVMNQMSQQNNFPLQSMHPR
ANAMRPRTNTPKQLRMQLQQRLQGQQFMNQTRQALEMKMENPGSSNSSVMRPVMQPQQGF
LNAQMVAQRNRELISHHFRQQRMAMMMQQQQSQAFSPPPNVTASGSIDSGLTGPPMAQVP
PQQFSYPPNYGISQQPDPAYGRVSSPPNPMIASRIGPSQNPMMQHPQTAPMYQSPEMKGW
PSGNMARSSSFPQQQFSHQGNPATYSMMHMNGSSGHIGQMNISTVPMSGMPMGPDQEIRT
TFQL
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagaaaactccttggatagcttgaccagtgagtcaaggaagcgcaag
ccgctgccctgtgatactccaggtgcaagtctgacctgcagtggtgagaagcgtcgacgt
gagcaggaaagcaaatacattgaagaactggctgaactgatatctgctaatctgagtgac
attgacaatttcaatgtcaaaccagacaaatgtgctattttaaaagaaactgtgagacag
attcgacagataaaggaacaaggaaaagcagtttccaatgatgatgatgttcagaaagct
gatgtgtcttccacaggtcaaggagttattgataaggactccttgggacctcttttacta
caggcattggacggtttcctgttcgttgtcaatcgagatgggaacatagtatttgtgtca
gaaaatgtcacacagtatttgcaatataaacaggaagatttggttaatacaagtgtctat
ggtatcttgcatgaagaggaccggaaggacttccttaaaaatttacccaaatcttcagtt
aatggagttgcttggaccaatgacacacctagacagaagagtcatacatttaattgtcgg
atgatggtgaaaacttcccatgatcttttggaagatgtaggcagccaccaggatacacgc
cagagatatgaaacaatgcagtgctttgctttatctcagccaagagctataatggaagag
ggagaagagcagaatggatatcgaccgaatcctaatgcagttgggcaaaacatcagaaca
acagtggctgggaatacaaattctgttggtcttatgaacatgtcacctggtcaaggcatg
ccaatgcagaacaggaactacggcatgggagatcccaatacagtgggtcagctgagtagc
tctcgatatggaggccctggtaatatgggaccagtgaactctggaccaggaatgcaatcc
tctgcttatcagagcaacagttatgggttgaatataagtagcccaccacatggtagtcct
ggtttaacttccaaccaacagaatctaatgatatctactaggaatcgagggagtccaaaa
atgaattcacaccaattttctccagttacaggtatgcactctccaatgggatctgccagc
aacaccagcaacagcactttctctagcagttctcttagtgctcttcaagccattagtgag
ggggttggaacttcccttttatcaacactttcttcaccaggtccaaaattggatagttct
ccaaatgtgagcatagctcagcaaaataaagcaaataaccaggactccaaaagcccttcg
ggcttatattgtgaacaaaatcaagtggaaagttccatctgccaatcaaacagcagggat
gtccttagtgaaaaagatagtaaagagggaagtctggatgcacctgaaagtcagagagga
cagtctgaaagcaaagggcataaaaagctgcttcagctactcacatgctcttcagatgaa
agaggacattctacagcatcaaactcacctttggactctaattgtaaagaatcttctacc
aacgttaccagtccttcaggagtttcctcatcgacatctggaggggtgtcttcctcctca
aatgtgcatgggtcactcctgcaagagaagcataggattttacataaattgttgcaaaat
ggtaattcccctgcagaggttgccaaaataacatctgggcatcccttggctgcctgtaac
cagagacaaagttgctgcaaacttgtcaacatcgacacaaactcgttgcgatcttccatg
agacctggctttgaggatacaattcgccggtgtattcagaggttcttatgccataatgat
ggacagtcatggtcaaacaaacgccactatcatgaagcttatacacaaggtcatgctgaa
acaccgttgtatcgcttttccctagcggatggaactatagtgacagcacaaacaaagagt
aaagtgtttagaaatccagtaactaatgaccgccatggatttatgagtggagacttggat
aatttggatgcaattttaggggatctgactagttcagacttttataataatgctatgtct
acaagtggaaatagctttggaacaaagcaagcattatttcaaggaaatgctcccctgagt
atgaggagtccccagtcggtgcagactacccgtccgcctttcaacagagccatgtcttta
gacagccctgtaggctcaggtgcttcagtgaggaatgtcaatgcattctccatgttacaa
aagcaaaacttgatgggtggaagtccaaggatggctgaaaaccaggaaagcttcggagca
aatattggagactggggtttgccaaactcgaaggttaacagattggaacctacaagttct
acttccatgttgagacaaggagctgagttcagtgcatcccttcccagacccacagcaggt
ggctccatgcctgggctgcccatccgttctaacagcatccccgggacaagaccaatgtta
caacagcaaatgatgcatatgaggtcaaatgagattaacattggtatgggggggaatcct
tacggacagccagggccagccagccagccaggatcgtggcctgacaacatgctgtccatg
gagcaagcatcacggggtttacaaaacagacaattagtgagaaactctttggatgacctc
ttaagtgcagcaccaagtgtggaaggccagaatgatgaaagggctcttttggatcaactg
cacacattgctgagtaatacagatgtcacaagcctggaagaaattgacagagctctagga
attcctgatcttgtaaaccaagggcaaactttggaacccaagcaagattcatttcaaggt
caggaatccgcagtgatgattgaccaaaagccttcgttatatggtcagccctaccaaggg
cagggcacagccttgccaggaggctttaataacatccagggacagcagccatcctttaat
tctgtgatgaatcagatgagccaacaaaacaattttccacttcaaagtatgcatcctaga
gcaaatgcaatgagacctcggaccaatacgccaaagcagctccgcatgcagctccagcag
aggcttcaggggcagcagtttatgaatcaaacccgtcaagcgcttgaaatgaaaatggaa
aatccaggcagtagtaatagctcagtgatgagaccagtaatgcagccacagcaaggtttt
cttaatgctcaaatggtggctcagcgtaacagggagctaataagtcatcattttagacaa
cagaggatggcaatgatgatgcagcagcaacaatctcaggccttcagtccaccaccgaat
gtgactgcctcaggaagcatagatagtggtctgactggccctccaatggctcaagttcct
ccacagcaattctcctatccacctaattatggaataagccaacagcctgaccctgcatat
ggtagagtatcaagccctcccaatccaatgatagcatcaagaattggaccttcacagaac
cctatgatgcagcatcctcagacagcacccatgtaccagtctcctgagatgaagggctgg
ccatcggggaacatggccaggagcagttctttcccacagcaacagttcagtcatcaaggt
aatcctgcaacgtacagtatgatgcacatgaatggcagcagtggccatattggacagatg
aacattagtactgtgcctatgtcagggatgcctatgggtccggaccaggaaatcaggacc
actttccagttataa

DBGET integrated database retrieval system