KEGG   Meleagris gallopavo (turkey): 100541294Help
Entry
100541294         CDS       T01523                                 

Gene name
PRKG2
Definition
protein kinase, cGMP-dependent, type II
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Gap junction
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100541294 (PRKG2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100541294 (PRKG2)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100541294 (PRKG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 755 aa AA seqDB search
MGNASMKPKHLRQPDRHIANLALVDVLCSRVLELEKELKRKDEELQEGQSLVAELQDQLS
VQTKVIAELTKELQSKCIQLNKLQDVINTQGEHSLQPSPYRVTPKHQVSADRRKGAKEGV
SAEPTTQLYDSGKQARFSFEKSRVRKDSSEKKLITDALNKNQFLKRLEPQQIREMVECMY
ERTFQQGSYVIRQGEPGNHIFVLKEGRLEVFQQNKLLSSIPVWTAFGELAILYNCTRTAS
VKAITNVKTWALDREVFQNIMRVTAQTRQEQYRNFLRSVSLLKNLPEDKLTKIMDCLEVE
YYDKGDYVIREGEEGNTFFIIAKGKVKVTQSTADHSQPQLIKNLHKGDYFGEKALISDDV
RSANVIADEYDVECLVIDRETFNQTVGTYEELQTYLEGYVANLARADEKRHAKRSFCGQS
TKEVSLEMIQLKEKVAQFPSSPFQNLEVVTTLGVGGFGRVELVKVKNENMAFAMKCIKKK
HVVDTKQQEHIYSEKKILEQICSPFIVKLYRTFKDSKYVYMLLEACLGGELWSLLRDRGS
FDEPTTKFCVGCVTEALDYLHHIGIVYRDLKPENLILDAEGYIKLVDFGFAKKIGSGQKT
WTFCGTPEYVAPEVILSKGHDFSVDFWSLGILVYELLTGSPPFSGADQMTTYNLILKGIE
KLDFPRTITRRPEDLIRRLCRQNPTERLGNLRNGINDIKKHRWLNGFNWDGLKLRKLASP
LKRELSGPTDYSYFDSYPPEEGMPPDELSGWDKDF
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgcatcaatgaaacccaaacatctgaggcagccggacagacacatagcaaac
ctagctcttgttgatgtgctttgcagcagagtgcttgaactggaaaaggagctgaaaaga
aaagatgaagagttgcaagagggtcaaagccttgttgctgagcttcaggatcagctgtct
gtgcagactaaagtcatagcagaactcaccaaggaacttcagagcaagtgcatacagctg
aacaagctgcaggatgttattaacactcaaggagaacactctctccagccttctccatat
agagtgactccaaagcatcaagtctctgctgacagaaggaaaggagctaaggagggtgta
tctgcagagccaacaacacagctctacgattccggcaaacaagctagattttcctttgaa
aaatcaagagtccgaaaggattccagtgagaagaagctcatcacagatgccctgaacaaa
aatcagttcttgaagagactggagcctcagcagatccgagagatggtggaatgtatgtac
gagaggactttccagcaggggagctatgtcatcagacaaggagagcctggcaatcacatt
tttgtcctcaaagagggcagactggaagtcttccagcagaataaactgctctcctccata
cctgtgtggacggcatttggtgaactggccattttatacaactgcacgcggacggcttcc
gtgaaagcaatcaccaatgttaaaacatgggcactggacagagaagtgtttcaaaacatc
atgagagtgacagcacagacaagacaagaacagtacagaaactttcttagaagtgtgtcc
ctcttaaaaaacttaccagaagataaattgaccaaaatcatggactgcctggaggtggag
tactatgacaaaggagattatgttattcgggaaggagaagaaggaaataccttctttata
atagcaaaaggaaaggtaaaggttacccagagtactgcagatcactcacagcctcagctg
attaaaaatctgcataaaggagattactttggagaaaaggccctcattagtgatgacgtc
agatcagcaaacgttattgcggatgaatatgacgtggagtgccttgtaatagatagagag
acatttaatcaaactgttggaacttatgaggagttacaaacctatcttgaaggttatgtg
gccaacctggcccgagctgacgaaaagcgacatgccaaaagatccttctgtggacagtca
accaaagaggtgtctttggagatgatacaactgaaggagaaagtagcccagttcccttct
tccccattccagaatttagaagttgtcacaactctcggtgttggtgggttcggaagggtt
gagcttgttaaggtaaaaaatgagaacatggcatttgctatgaagtgtataaagaagaaa
catgtagtggacaccaaacaacaagagcatatatattctgaaaagaaaatccttgagcag
atatgttctcctttcattgtaaaactgtatcgcacatttaaggatagtaagtacgtgtac
atgctgctggaggcttgccttggtggggagttgtggagcttgctgagagacagaggcagc
tttgatgaacccactacaaagttctgtgttggatgtgtgacagaggctttggactatcta
catcacataggaattgtctacagagacttgaagccagaaaacttaattttggatgctgaa
ggatatataaaattggttgattttggatttgcaaaaaagatcggatcagggcagaaaacc
tggacgttctgtggaacccctgagtatgttgctccagaagtcattctgagtaagggccat
gacttcagtgtggatttttggtcccttgggattcttgtgtatgagctccttactggcagc
ccaccattctctggggctgatcagatgacaacatataatttgattctaaaaggcattgaa
aaactggattttcctagaacaataacaaggcggcctgaggatttgatccgcagactctgc
aggcagaacccgacagaaagattaggcaatctgaggaatgggattaatgacattaagaag
cacaggtggttgaatggttttaactgggatggtctgaaattgaggaaattagcatcacct
ttaaaaagagagttatccggaccaactgattacagctactttgacagctatccacctgaa
gagggaatgcctccagatgaactttctggctgggacaaggatttctga

DBGET integrated database retrieval system