KEGG   Meleagris gallopavo (turkey): 100541403Help
Entry
100541403         CDS       T01523                                 

Gene name
CHP1
Definition
(RefSeq) calcineurin-like EF-hand protein 1
  KO
K17610  
calcineurin B homologous protein 1
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100541403 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 195 aa AA seqDB search
MGSRASTLLRDEEIEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDQNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDCAISFAEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccgggcgtctacgctgctccgagatgaggagatcgaggagatcaagaaggag
acgggcttctcccacagtcaaatcactcgcttgtatagtcgcttcaccagcctagacaaa
ggagaaaatggcactcttagccgtgaagacttccagcggattccagagcttgccatcaat
cctctgggagaccgaattatcaatgcctttttttcagaaggagaggaccaagtgaatttc
cgtggattcatgaggacactagcccacttccggcccatagaagataatgaaaagagcaaa
gaccagaatggaccagaaccactgaacagccgaagtaacaagctccactttgcttttcgg
ttatatgatctagataaagatgacaagatttccagggatgagcttcttcaggtgttacgg
atgatggtcggtgtcaacatctcagatgagcagcttggcagcattgctgacaggacaatc
caggaagctgatcaagatggggattgtgccatctcctttgcagagtttgtaaaggttttg
gagaaggtggatgtagagcagaaaatgagtattcgatttcttcactga

DBGET integrated database retrieval system