KEGG   Meleagris gallopavo (turkey): 100541406Help
Entry
100541406         CDS       T01523                                 

Definition
enoyl-CoA hydratase, mitochondrial-like
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:mgp01200]
Metabolism; Overview; Fatty acid metabolism [PATH:mgp01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mgp00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mgp00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:mgp00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:mgp00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mgp00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mgp00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mgp00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mgp00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 225 aa AA seqDB search
MEELGRALDAFEADGQVGAIVITGSEKAFAAGADIKEMQNKTFQECYSGGFLAGWDRVAT
IRKPTVAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGK
SLAMEMVLTGERISAAEAKAAGLVSKVFPTDKLLDAAIGCAEKIAANSKLVVAMAKESVN
AAFETTLTEGNKTEKRLFYATFATDDRKEGMTAFVEKRKANFTDS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctggggcgtgcactggacgccttcgaggccgacgggcaggtgggagcaatt
gtcatcaccggcagtgagaaggcctttgcagccggcgctgacattaaagagatgcagaac
aaaaccttccaggagtgctatagtggcggtttcctggctggctgggatcgggtggccact
atccgcaagcccaccgtcgccgccgttaatggcttcgctctgggcggcggctgcgaactg
gccatgatgtgcgacatcatctatgccggggagaaggcgcagtttgggcagcccgagatc
ctgctggggacaatcccaggcgccggcggaacgcagaggctgaccagggcagtgggcaag
tccctggccatggagatggtgctgactggggagcggatctcggcagcggaggccaaagcg
gcaggtctggtcagcaaagtcttccccacggacaagctgctggacgcagccattggctgc
gctgagaagatagctgccaactccaaactggtggtagctatggccaaggagtccgtcaat
gctgctttcgaaacaacactgacagaggggaacaagacagagaagcgtctcttctatgcc
acttttgccaccgacgaccgcaaggaagggatgactgcgtttgtggagaagcgcaaggcc
aacttcactgacagttga

DBGET integrated database retrieval system