KEGG   Meleagris gallopavo (turkey): 100541406Help
Entry
100541406         CDS       T01523                                 

Definition
enoyl-CoA hydratase, mitochondrial-like
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100541406
   01212 Fatty acid metabolism
    100541406
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100541406
   00650 Butanoate metabolism
    100541406
  Lipid metabolism
   00062 Fatty acid elongation
    100541406
   00071 Fatty acid degradation
    100541406
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100541406
   00310 Lysine degradation
    100541406
   00380 Tryptophan metabolism
    100541406
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100541406
Enzymes [BR:mgp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100541406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 225 aa AA seqDB search
MEELGRALDAFEADGQVGAIVITGSEKAFAAGADIKEMQNKTFQECYSGGFLAGWDRVAT
IRKPTVAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGK
SLAMEMVLTGERISAAEAKAAGLVSKVFPTDKLLDAAIGCAEKIAANSKLVVAMAKESVN
AAFETTLTEGNKTEKRLFYATFATDDRKEGMTAFVEKRKANFTDS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctggggcgtgcactggacgccttcgaggccgacgggcaggtgggagcaatt
gtcatcaccggcagtgagaaggcctttgcagccggcgctgacattaaagagatgcagaac
aaaaccttccaggagtgctatagtggcggtttcctggctggctgggatcgggtggccact
atccgcaagcccaccgtcgccgccgttaatggcttcgctctgggcggcggctgcgaactg
gccatgatgtgcgacatcatctatgccggggagaaggcgcagtttgggcagcccgagatc
ctgctggggacaatcccaggcgccggcggaacgcagaggctgaccagggcagtgggcaag
tccctggccatggagatggtgctgactggggagcggatctcggcagcggaggccaaagcg
gcaggtctggtcagcaaagtcttccccacggacaagctgctggacgcagccattggctgc
gctgagaagatagctgccaactccaaactggtggtagctatggccaaggagtccgtcaat
gctgctttcgaaacaacactgacagaggggaacaagacagagaagcgtctcttctatgcc
acttttgccaccgacgaccgcaaggaagggatgactgcgtttgtggagaagcgcaaggcc
aacttcactgacagttga

DBGET integrated database retrieval system