KEGG   Meleagris gallopavo (turkey): 100541406Help
Entry
100541406         CDS       T01523                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, short chain 1
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00062  Fatty acid elongation
mgp00071  Fatty acid degradation
mgp00280  Valine, leucine and isoleucine degradation
mgp00310  Lysine degradation
mgp00380  Tryptophan metabolism
mgp00410  beta-Alanine metabolism
mgp00640  Propanoate metabolism
mgp00650  Butanoate metabolism
mgp01100  Metabolic pathways
mgp01200  Carbon metabolism
mgp01212  Fatty acid metabolism
Module
mgp_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
mgp_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
mgp_M00085  Fatty acid biosynthesis, elongation, mitochondria
mgp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100541406 (ECHS1)
   00650 Butanoate metabolism
    100541406 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    100541406 (ECHS1)
   00071 Fatty acid degradation
    100541406 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100541406 (ECHS1)
   00310 Lysine degradation
    100541406 (ECHS1)
   00380 Tryptophan metabolism
    100541406 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100541406 (ECHS1)
Enzymes [BR:mgp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100541406 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 100541406
NCBI-ProteinID: XP_003207855
Ensembl: ENSMGAG00000001849
Position
8
AA seq 283 aa AA seqDB search
MRLRAPAPALSPHNGARSPGRAGPPFRFLQVQKVGAGDSVGLIRLQRPEALNALCAGLME
ELGRALDAFEADGQVGAIVITGSEKAFAAGADIKEMQNKTFQECYSGGFLAGWDRVATIR
KPTVAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSL
AMEMVLTGERISAAEAKAAGLVSKVFPTDKLLDAAIGCAEKIAANSKLVVAMAKESVNAA
FETTLTEGNKTEKRLFYATFATDDRKEGMTAFVEKRKANFTDS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgcgtgcaccagccccggccctgtcgccccataatggcgcgcggtcacctggc
cgcgcagggcccccgttccgcttcctgcaggtgcaaaaggtcggggcgggcgacagcgtg
gggctgatccggctgcagcggcccgaggcgctcaacgcgctctgtgcggggctgatggag
gagctggggcgtgcactggacgccttcgaggccgacgggcaggtgggagcaattgtcatc
accggcagtgagaaggcctttgcagccggcgctgacattaaagagatgcagaacaaaacc
ttccaggagtgctatagtggcggtttcctggctggctgggatcgggtggccactatccgc
aagcccaccgtcgccgccgttaatggcttcgctctgggcggcggctgcgaactggccatg
atgtgcgacatcatctatgccggggagaaggcgcagtttgggcagcccgagatcctgctg
gggacaatcccaggcgccggcggaacgcagaggctgaccagggcagtgggcaagtccctg
gccatggagatggtgctgactggggagcggatctcggcagcggaggccaaagcggcaggt
ctggtcagcaaagtcttccccacggacaagctgctggacgcagccattggctgcgctgag
aagatagctgccaactccaaactggtggtagctatggccaaggagtccgtcaatgctgct
ttcgaaacaacactgacagaggggaacaagacagagaagcgtctcttctatgccactttt
gccaccgacgaccgcaaggaagggatgactgcgtttgtggagaagcgcaaggccaacttc
actgacagttga

DBGET integrated database retrieval system