KEGG   Meleagris gallopavo (turkey): 100541406Help
Entry
100541406         CDS       T01523                                 

Gene name
ECHS1
Definition
(RefSeq) enoyl-CoA hydratase, short chain 1
  KO
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100541406 (ECHS1)
   01212 Fatty acid metabolism
    100541406 (ECHS1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100541406 (ECHS1)
   00650 Butanoate metabolism
    100541406 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    100541406 (ECHS1)
   00071 Fatty acid degradation
    100541406 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100541406 (ECHS1)
   00310 Lysine degradation
    100541406 (ECHS1)
   00380 Tryptophan metabolism
    100541406 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100541406 (ECHS1)
Enzymes [BR:mgp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100541406 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 283 aa AA seqDB search
MRLRAPAPALSPHNGARSPGRAGPPFRFLQVQKVGAGDSVGLIRLQRPEALNALCAGLME
ELGRALDAFEADGQVGAIVITGSEKAFAAGADIKEMQNKTFQECYSGGFLAGWDRVATIR
KPTVAAVNGFALGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSL
AMEMVLTGERISAAEAKAAGLVSKVFPTDKLLDAAIGCAEKIAANSKLVVAMAKESVNAA
FETTLTEGNKTEKRLFYATFATDDRKEGMTAFVEKRKANFTDS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgcgtgcaccagccccggccctgtcgccccataatggcgcgcggtcacctggc
cgcgcagggcccccgttccgcttcctgcaggtgcaaaaggtcggggcgggcgacagcgtg
gggctgatccggctgcagcggcccgaggcgctcaacgcgctctgtgcggggctgatggag
gagctggggcgtgcactggacgccttcgaggccgacgggcaggtgggagcaattgtcatc
accggcagtgagaaggcctttgcagccggcgctgacattaaagagatgcagaacaaaacc
ttccaggagtgctatagtggcggtttcctggctggctgggatcgggtggccactatccgc
aagcccaccgtcgccgccgttaatggcttcgctctgggcggcggctgcgaactggccatg
atgtgcgacatcatctatgccggggagaaggcgcagtttgggcagcccgagatcctgctg
gggacaatcccaggcgccggcggaacgcagaggctgaccagggcagtgggcaagtccctg
gccatggagatggtgctgactggggagcggatctcggcagcggaggccaaagcggcaggt
ctggtcagcaaagtcttccccacggacaagctgctggacgcagccattggctgcgctgag
aagatagctgccaactccaaactggtggtagctatggccaaggagtccgtcaatgctgct
ttcgaaacaacactgacagaggggaacaagacagagaagcgtctcttctatgccactttt
gccaccgacgaccgcaaggaagggatgactgcgtttgtggagaagcgcaaggccaacttc
actgacagttga

DBGET integrated database retrieval system