KEGG   Meleagris gallopavo (turkey): 100541412Help
Entry
100541412         CDS       T01523                                 

Gene name
PAK2
Definition
p21 protein (Cdc42/Rac)-activated kinase 2
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100541412 (PAK2)
   04012 ErbB signaling pathway
    100541412 (PAK2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100541412 (PAK2)
  Cellular commiunity
   04510 Focal adhesion
    100541412 (PAK2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100541412 (PAK2)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   100541412 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 521 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSYGGKDPLSANHSLKPLPSVPEERKPRNKIISIFSSTEKGS
KKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVL
DVLKFYDSKDTAKQKYLSFSAPEKDGFPSGTPTTNAKGSEPSTAVADDDDDDEEAPPPII
APRPDHTKSIYTRSVIDPIPAPAGDASVDGGTKSGDKQKKKTKMSDEEIMEKLRTIVSIG
DPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINEILVMKELKN
PNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQ
VIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPK
VDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEM
DVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaacggagaactggaagacaagccaccagctcctcctgtgcggatgagcagc
tatgggggaaaggacccgttgtctgccaaccacagcttgaaacctctgccctccgtacca
gaagagagaaaacctaggaataaaatcatctccatattctctagcactgaaaaaggaagc
aagaagaaggaaaaggaacgaccagaaatctccccgccgtcagactttgagcatactatc
catgttggctttgatgctgtcactggagagttcactggaatgccagagcaatgggctcgg
ttgctacagacctcaaatatcaccaagttagaacagaagaaaaaccctcaggcggtacta
gatgtgctgaaattctacgactccaaagacacagcaaaacagaaatatctgagcttttct
gctccagaaaaagatggtttcccttcaggaacaccaacgaccaacgccaaaggttcagag
ccatcaacagctgtggcggatgatgatgatgatgatgaagaagcaccacctcctattatt
gctccgcgcccagatcacacgaaatcgatttatacacggtctgtaattgaccccatccct
gcaccagctggtgacgcttctgttgacggtgggacaaagtcaggtgataagcagaagaag
aagaccaaaatgtcagatgaagagatcatggaaaaactacgtactattgtgagcataggt
gatcccaagaaaaaatacaccagatatgaaaaaattgggcaaggggcttcaggtacagtt
ttcacagctattgatgtggctactgggcaggaggttgctatcaaacagataaacctgcag
aaacagcccaagaaggagttgattattaatgagatcttggtaatgaaggagctaaagaac
cccaacatagtcaacttcctggacagttacctcgtaggagatgaactgtttgtggtgatg
gaatatctagctggaggctcactaacagatgtggtcacggaaacgtgtatggatgaagca
cagattgctgctgtttgcagagagtgcttgcaagcgcttgagttcctccatgccaaccag
gtcatccatagagatataaagagcgacaacgtgctgctaggaatggatggatcagttaaa
ctaaccgactttggtttctgtgctcagatcaccccagagcagagcaagcgcagcactatg
gttggaactccttactggatggctcctgaagtcgtcacacggaaagcctatggccctaaa
gtggatatctggtccctaggcatcatggctattgagatggtggaaggagaacccccgtac
ctcaatgaaaaccccctgagggccttatatttgatagcaactaatggcacaccagagctt
cagaaccctgagaaactgtccccaatatttcgggatttcttaaaccgatgtttggagatg
gatgttgagaaaagaggatcagccaaagaattgctacagcatcccttcttgaaactggcc
aaacctctgtctagcttgacgccactgatcctggcagccaaagaagcaatgaagagtaac
cgctaa

DBGET integrated database retrieval system