KEGG   Meleagris gallopavo (turkey): 100541412Help
Entry
100541412         CDS       T01523                                 

Definition
serine/threonine-protein kinase PAK 2-like
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100541412
   04012 ErbB signaling pathway
    100541412
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100541412
  Cell communication
   04510 Focal adhesion
    100541412
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100541412
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   100541412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 518 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSYGGKDPLSANHSLKPLPSVPEERKPRNKIISIFSSTEKGS
KKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVL
DVLKFYDSKDTAKQKYLSFSAPEKDGFPSGTPTTNAKGSEPSTAVADDDDDDEEAPPPII
APRPDHTKSIYTRSVIDPIPAPAGDASVDGGTKSGDKQKKKTKMSDEEIMEKLRTIVSIG
DPKKKYTRYEKIGQGASGTVFTAIDVATGQECLMSVEEKEARRVLSSGEKLKEEFHCCFQ
LSSGESYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIH
RDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDI
WSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVE
KRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaacggagaactggaagacaagccaccagctcctcctgtgcggatgagcagc
tatgggggaaaggacccgttgtctgccaaccacagcttgaaacctctgccctccgtacca
gaagagagaaaacctaggaataaaatcatctccatattctctagcactgaaaaaggaagc
aagaagaaggaaaaggaacgaccagaaatctccccgccgtcagactttgagcatactatc
catgttggctttgatgctgtcactggagagttcactggaatgccagagcaatgggctcgg
ttgctacagacctcaaatatcaccaagttagaacagaagaaaaaccctcaggcggtacta
gatgtgctgaaattctacgactccaaagacacagcaaaacagaaatatctgagcttttct
gctccagaaaaagatggtttcccttcaggaacaccaacgaccaacgccaaaggttcagag
ccatcaacagctgtggcggatgatgatgatgatgatgaagaagcaccacctcctattatt
gctccgcgcccagatcacacgaaatcgatttatacacggtctgtaattgaccccatccct
gcaccagctggtgacgcttctgttgacggtgggacaaagtcaggtgataagcagaagaag
aagaccaaaatgtcagatgaagagatcatggaaaaactacgtactattgtgagcataggt
gatcccaagaaaaaatacaccagatatgaaaaaattgggcaaggggcttcaggtacagtt
ttcacagctattgatgtggctactgggcaggagtgcttaatgtctgtggaagagaaggaa
gctcggagagttctgtccagtggtgagaagctcaaagaagaatttcactgctgttttcag
ctttctagtggggaaagttacctcgtaggagatgaactgtttgtggtgatggaatatcta
gctggaggctcactaacagatgtggtcacggaaacgtgtatggatgaagcacagattgct
gctgtttgcagagagtgcttgcaagcgcttgagttcctccatgccaaccaggtcatccat
agagatataaagagcgacaacgtgctgctaggaatggatggatcagttaaactaaccgac
tttggtttctgtgctcagatcaccccagagcagagcaagcgcagcactatggttggaact
ccttactggatggctcctgaagtcgtcacacggaaagcctatggccctaaagtggatatc
tggtccctaggcatcatggctattgagatggtggaaggagaacccccgtacctcaatgaa
aaccccctgagggccttatatttgatagcaactaatggcacaccagagcttcagaaccct
gagaaactgtccccaatatttcgggatttcttaaaccgatgtttggagatggatgttgag
aaaagaggatcagccaaagaattgctacagcatcccttcttgaaactggccaaacctctg
tctagcttgacgccactgatcctggcagccaaagaagcaatgaagagtaaccgctaa

DBGET integrated database retrieval system