KEGG   Meleagris gallopavo (turkey): 100541549Help
Entry
100541549         CDS       T01523                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100541549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 242 aa AA seqDB search
MQNAAQRGGSNWLTREGGRERGPITADTAGPGENGIIKSDKVFEVMLATDRCHYAKYNPY
MDSPQSIGFQATISAPHMHAYALELLSDQLHEGAKALDVGSGSGILTACFSRMVGPKGQV
VGIDHIKELVDDSINNVKKDDPTLLSSGRVKLIVGDGRMGYAEDAPYDAIHVGAAAPVVP
QALIDQLKPGGRLILPVGPAGGNQMLEQYDKLEDGSVKMKPLMGVIYVPLTDKEKQWSRD
EL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgccgcgcagcgaggcggcagtaattggctgactcgtgagggcggcagggag
cgcgggccaataacggccgacactgccgggccgggcgaaaatggaataatcaaatcagac
aaggtatttgaagtaatgctggctacagaccgttgccactatgcaaaatacaacccttat
atggattctcctcaatctataggcttccaagcaacaatcagtgctccacatatgcatgca
tatgctcttgaacttctgtccgatcaattacatgaaggagccaaagctcttgatgtggga
tctggaagtggaatccttacagcatgcttttcacgaatggttggtcccaaaggacaagtt
gtaggaattgatcatatcaaagaactagtagatgactcaataaataatgtcaaaaaagac
gatcccacattgctgtcttcaggaagagtgaaactgattgtgggagatggaagaatggga
tatgcagaagatgctccctatgatgcaattcatgtaggagctgcagcaccagttgtgccc
caagcacttatagatcagttaaaacctggcggaagattgatattaccagttggtcctgca
gggggaaaccagatgcttgaacagtacgacaaactagaagatggcagtgtcaaaatgaag
cctctgatgggagtgatatatgtgcctttaacagacaaagagaagcagtggtccagggat
gaattgtaa

DBGET integrated database retrieval system