KEGG   Meleagris gallopavo (turkey): 100541808Help
Entry
100541808         CDS       T01523                                 

Definition
angiopoietin-2-like
Orthology
K05466  
angiopoietin 2
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 493 aa AA seqDB search
MRLSVYFTWGCSIVLAAGYNAFGKGAEPAGKKQYRVQHGPCSYTFLLPEADSCRPPYVPN
AVQRDAPLDYDDSVQRLQLLENIMENNTQWLLKLENYIQDSMKKEMVEIQQTAVQNQTAV
MIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLERQISVQTSEITK
LQEKNSFLEKRVLEMEDKHTLQLKSIKDEKDQLQVLVARQNSIIEELEKQLVTATVNNSV
LQKQQHDLMETVHNLLTMISTPNSAKNNFIAKEEQISFKDCAEAFKSGLTTSGIYTLTFP
NTAQEKKAYCDMESNGGGWTVLQRREDGSVDFHRTWKEYKIGFGDPAGEYWLGNEFVSQL
TNQKRYVLKIILKDWEGNEAYTLYDQFYLASEEQKYRIHLKGLTGTAGKISSISQPGNDF
STKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPLRQNNNKFNGIKWYYWKGSGYS
LKATTMMIRPADF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgagcgtctacttcacgtggggctgcagcatcgtcctcgccgcgggatacaac
gccttcgggaagggcgcggagccggcgggcaagaagcagtaccgggtccagcacgggccg
tgcagctacaccttcctgctgcccgaggccgacagctgccggccgccctacgtgcccaac
gccgtgcagcgcgacgcgccgcttgactacgacgactccgtgcagaggctgcagctgctg
gagaacatcatggagaacaacacccagtggctcctgaagcttgagaattacatccaagac
agtatgaagaaagaaatggtagagatccagcaaactgcagtgcagaaccagactgcagta
atgattgaaataggcacaaacttactaaatcaaacagctgagcagacccgcaaattaaca
gatgttgaagcacaagtactaaaccagacaaccagacttgaacttcagcttttggaacat
tccctttcaacaaataaattagaaagacagatttctgttcagaccagcgagataactaaa
ttacaagaaaaaaacagctttctagaaaaaagagttcttgagatggaagacaagcacact
cttcagctgaagtcaataaaagacgaaaaagatcagcttcaagtcctagtagccagacag
aattccattatagaagaactagaaaagcagttagttacagctacggtaaacaactctgtt
ctgcaaaaacagcaacatgatttgatggagactgttcataacttactcactatgatatct
acaccaaactcagctaagaataacttcatagctaaagaggagcaaatcagcttcaaagac
tgtgctgaagctttcaaatctggactcacaacaagtggaatctacaccttaacatttcct
aacactgcacaggaaaagaaggcctactgtgacatggaaagcaatggaggagggtggaca
gttcttcagagacgtgaagatggcagtgtggattttcaccggacgtggaaagagtacaag
ataggatttggtgatcctgctggggagtactggctaggaaatgagtttgtttctcaattg
actaatcagaagcgctatgttcttaaaataatcctgaaagactgggaaggaaatgaagcg
tatactttgtatgaccaattctatctagcaagtgaagaacaaaaatacaggatccacctt
aaaggacttactgggacagcaggcaaaataagtagtataagccaaccaggaaatgatttt
agcacaaaggatgcagacaatgacaaatgtatttgcaaatgttcacaaatgctaacagga
gggtggtggtttgatgcatgtggtccttctaacctcaatggaatgtattatccattacga
cagaacaacaacaagttcaatggtattaagtggtactactggaaaggctcaggatactct
ctcaaagccacgactatgatgattcgaccagcagatttctaa

DBGET integrated database retrieval system