KEGG   Meleagris gallopavo (turkey): 100541808Help
Entry
100541808         CDS       T01523                                 

Gene name
ANGPT2
Definition
(RefSeq) angiopoietin 2
  KO
K05466  
angiopoietin 2
Organism
mgp  Meleagris gallopavo (turkey)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 358 aa AA seqDB search
MDGREINLLNVLNQTTRLELQLLEHSLSTNKLERQISVQTSEITKLQEKNSFLEKRVLEM
EDKHTLQLKSIKDEKDQLQVLVARQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHNL
LTMISTPNSAKNNFIAKEEQISFKDCAEAFKSGLTTSGIYTLTFPNTAQEKKAYCDMESN
GGGWTVLQRREDGSVDFHRTWKEYKIGFGDPAGEYWLGNEFVSQLTNQKRYVLKIILKDW
EGNEAYTLYDQFYLASEEQKYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCS
QMLTGGWWFDACGPSNLNGMYYPLRQNNNKFNGIKWYYWKGSGYSLKATTMMIRPADF
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggatggcagagaaataaacttacttaatgtactaaaccagacaaccagacttgaactt
cagcttttggaacattccctttcaacaaataaattagaaagacagatttctgttcagacc
agcgagataactaaattacaagaaaaaaacagctttctagaaaaaagagttcttgagatg
gaagacaagcacactcttcagctgaagtcaataaaagacgaaaaagatcagcttcaagtc
ctagtagccagacagaattccattatagaagaactagaaaagcagttagttacagctacg
gtaaacaactctgttctgcaaaaacagcaacatgatttgatggagactgttcataactta
ctcactatgatatctacaccaaactcagctaagaataacttcatagctaaagaggagcaa
atcagcttcaaagactgtgctgaagctttcaaatctggactcacaacaagtggaatctac
accttaacatttcctaacactgcacaggaaaagaaggcctactgtgacatggaaagcaat
ggaggagggtggacagttcttcagagacgtgaagatggcagtgtggattttcaccggacg
tggaaagagtacaagataggatttggtgatcctgctggggagtactggctaggaaatgag
tttgtttctcaattgactaatcagaagcgctatgttcttaaaataatcctgaaagactgg
gaaggaaatgaagcgtatactttgtatgaccaattctatctagcaagtgaagaacaaaaa
tacaggatccaccttaaaggacttactgggacagcaggcaaaataagtagtataagccaa
ccaggaaatgattttagcacaaaggatgcagacaatgacaaatgtatttgcaaatgttca
caaatgctaacaggagggtggtggtttgatgcatgtggtccttctaacctcaatggaatg
tattatccattacgacagaacaacaacaagttcaatggtattaagtggtactactggaaa
ggctcaggatactctctcaaagccacgactatgatgattcgaccagcagatttctaa

DBGET integrated database retrieval system