KEGG   Meleagris gallopavo (turkey): 100541808Help
Entry
100541808         CDS       T01523                                 

Gene name
ANGPT2
Definition
(RefSeq) angiopoietin-2
  KO
K05466  
angiopoietin 2
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Cytokines [BR:mgp04052]
 PDGF family
  Other growth factors
   100541808 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
2
AA seq 299 aa AA seqDB search
MEDKHTLQLKSIKDEKDQLQVLVARQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHN
LLTMISTPNSAKNNFIAKEEQISFKDCAEAFKSGLTTSGIYTLTFPNTAQEKKAYCDMES
NGGGWTVLQRREDGSVDFHRTWKEYKIGFGDPAGEYWLGNEFVSQLTNQKRYVLKIILKD
WEGNEAYTLYDQFYLASEEQKYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKC
SQMLTGGWWFDACGPSNLNGMYYPLRQNNNKFNGIKWYYWKGSGYSLKATTMMIRPADF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggaagacaagcacactcttcagctgaagtcaataaaagacgaaaaagatcagcttcaa
gtcctagtagccagacagaattccattatagaagaactagaaaagcagttagttacagct
acggtaaacaactctgttctgcaaaaacagcaacatgatttgatggagactgttcataac
ttactcactatgatatctacaccaaactcagctaagaataacttcatagctaaagaggag
caaatcagcttcaaagactgtgctgaagctttcaaatctggactcacaacaagtggaatc
tacaccttaacatttcctaacactgcacaggaaaagaaggcctactgtgacatggaaagc
aatggaggagggtggacagttcttcagagacgtgaagatggcagtgtggattttcaccgg
acgtggaaagagtacaagataggatttggtgatcctgctggggagtactggctaggaaat
gagtttgtttctcaattgactaatcagaagcgctatgttcttaaaataatcctgaaagac
tgggaaggaaatgaagcgtatactttgtatgaccaattctatctagcaagtgaagaacaa
aaatacaggatccaccttaaaggacttactgggacagcaggcaaaataagtagtataagc
caaccaggaaatgattttagcacaaaggatgcagacaatgacaaatgtatttgcaaatgt
tcacaaatgctaacaggagggtggtggtttgatgcatgtggtccttctaacctcaatgga
atgtattatccattacgacagaacaacaacaagttcaatggtattaagtggtactactgg
aaaggctcaggatactctctcaaagccacgactatgatgattcgaccagcagatttctaa

DBGET integrated database retrieval system