KEGG   Meleagris gallopavo (turkey): 100541808Help
Entry
100541808         CDS       T01523                                 

Gene name
ANGPT2
Definition
(RefSeq) angiopoietin-2
  KO
K05466  angiopoietin 2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100541808 (ANGPT2)
Cytokines and growth factors [BR:mgp04052]
 Growth factors
  Growth factors (RTK binding)
   100541808 (ANGPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C Spc29 CENP-H SHE3 CitX SlyX
Motif
Other DBs
NCBI-GeneID: 100541808
NCBI-ProteinID: XP_019468748
Ensembl: ENSMGAG00000013948
Position
2
AA seq 299 aa AA seqDB search
MEDKHTLQLKSIKDEKDQLQVLVARQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHN
LLTMISTPNSAKNNFIAKEEQISFKDCAEAFKSGLTTSGIYTLTFPNTAQEKKAYCDMES
NGGGWTVLQRREDGSVDFHRTWKEYKIGFGDPAGEYWLGNEFVSQLTNQKRYVLKIILKD
WEGNEAYTLYDQFYLASEEQKYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKC
SQMLTGGWWFDACGPSNLNGMYYPLRQNNNKFNGIKWYYWKGSGYSLKATTMMIRPADF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggaagacaagcacactcttcagctgaagtcaataaaagacgaaaaagatcagcttcaa
gtcctagtagccagacagaattccattatagaagaactagaaaagcagttagttacagct
acggtaaacaactctgttctgcaaaaacagcaacatgatttgatggagactgttcataac
ttactcactatgatatctacaccaaactcagctaagaataacttcatagctaaagaggag
caaatcagcttcaaagactgtgctgaagctttcaaatctggactcacaacaagtggaatc
tacaccttaacatttcctaacactgcacaggaaaagaaggcctactgtgacatggaaagc
aatggaggagggtggacagttcttcagagacgtgaagatggcagtgtggattttcaccgg
acgtggaaagagtacaagataggatttggtgatcctgctggggagtactggctaggaaat
gagtttgtttctcaattgactaatcagaagcgctatgttcttaaaataatcctgaaagac
tgggaaggaaatgaagcgtatactttgtatgaccaattctatctagcaagtgaagaacaa
aaatacaggatccaccttaaaggacttactgggacagcaggcaaaataagtagtataagc
caaccaggaaatgattttagcacaaaggatgcagacaatgacaaatgtatttgcaaatgt
tcacaaatgctaacaggagggtggtggtttgatgcatgtggtccttctaacctcaatgga
atgtattatccattacgacagaacaacaacaagttcaatggtattaagtggtactactgg
aaaggctcaggatactctctcaaagccacgactatgatgattcgaccagcagatttctaa

DBGET integrated database retrieval system