KEGG   Meleagris gallopavo (turkey): 100541837Help
Entry
100541837         CDS       T01523                                 

Gene name
LAMC3
Definition
(RefSeq) laminin, gamma 3
  KO
K06247  
laminin, gamma 3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100541837 (LAMC3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100541837 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 1576 aa AA seqDB search
MTRLRALALLGLVLATASSSPCYDPRGQPRRCMPVFENAAFGRVPLVTNTCGSPPEDYCL
QMGARDASQLCQRCDAADPLLHHNASFLTDFHSQEESTWWQSQSMAFGIQHPNSVNITLH
LGKSYEITYVRLKFHTSRPESFAIYKRSHSDGPWVPFQFYSASCEKTYRKRQRQYLRPGE
DEQVAFCTDEFSDISPLSGGNVAFSTLEGRPSAYNFDGSPTLQEWVTVTDLLISLNRLNT
FGDDIFKDPKVLQSYYYAISDFSVGGRCKCNGHASECAPDEAGRLVCVCQHNTAGPDCQH
CQPFYQDRPWARGTAEAANECLPCNCSGRSEECFYDAELFRRTGHGGHCRNCRDNTAGPR
CEQCRQNHYRWEQQAACQPCHCHPAGSLRPQCDRSGTCTCKANVTGWKCERCKDGYHSLS
EGGCRPCACDPAGSVGTCDPSTGHCTCKEKVEGHLCNRCQPGWFNLQPHTPTGCTSCFCY
GHSAVCTAADGYEVTHIHSDFREGLEGWAAAVEDVAVPLHWADGEIGTEWEKEEPLDLRA
PEKFLQNQRLSYGQPLSLLLRMEGNGTRAESGVFLLGIQLVLEGEGLEVTMSSSESQAQD
GKQTVTFRLHEAEEGTEPLLSAFSFQRLLSNLTALRLRVSRGPRPGRLWLSRVQLTSARR
GAGTRAGWVEECTCPSGYTGSFCESCAPGFKRDIPFGGPFVACVPCTCNQHGDCEPLSGR
CSCLHNTEGPSCERCSSGFYGNPFTGQPDDCKPCPCPDRSPCTQLPSSGDVVCTHCPPGQ
RGKRCELCDDGFFGDPLGQRGPVRPCIPCQCHGNVDLNAVGNCDSLSGRCLRCLHNTTGE
QCHQCQPGFYGDALAPSPAGKCAPCNCNPDGSALGLEGCDPGTGQCHCLPHVLGRTCELC
QHGYYGLQAAVGCKSCECHPMGSQDSGCHAVTGQCSCQPGVTGLRCDRCEHGFFGFSARG
CRACNCSPLGSASAQCYENSTCLCRPGFVGYKCDRCQANFFPDPPSSSCQPCPTCYGLVK
DGVERLRVKLQEVEEWLQEPGCELHLGQPLEMGDASRGDGLSTQHLLQGAHAMLSAQVGR
LSGMLSTAQGHLSNAIRASGCSSHGPIKTCTLLSEIRAVLQSAQREILHATNTLAATDIP
LEIPLLPTNWSRLAMEARVLAERHGDIAAQVEAAVRRALGASNTSHELLRTLLEGRVAHE
AQKELEAGYEEIQRAWKELGAGMEEVAVEARRALKAIQEANVGMAEKLQQVAAPGQQVLL
VQAGALEQEVAALEQTVQAQEPAAWQSITASLSMAAGLRRDLQGTQSFVQLQDRAGSAHD
LSTSAVSQGKAVISDAESLLGSLEGMRKALGHRKGRAALRRRMAQVRDRTMVEAQKKIKQ
AEKMLGNSLFVSSVARKKAEEAERVAGESSKRAQAVLQGSKQARKDTRTLTTRVSETQQE
LFQQQRMAEELRGSLEEAEQVGTEMSKMAKSLREARGSLMADIETLNDLLDSLGGLEPGM
QAEAVLGAGRLQLEQLRLRLSAPGALATRLGQLQQEAELQQDRIRAFESDLVEIRADKQN
LEDILRSLPEGCSKWQ
NT seq 4731 nt NT seq  +upstreamnt  +downstreamnt
atgacccggctcagggcgctggccctgctggggttggtgctggccactgcgagctcgtcc
ccctgctacgacccccgggggcagccccgccgctgcatgcccgtcttcgagaacgccgct
ttcggccgcgtcccgctggtcaccaacacgtgcggctcgccgcccgaggattactgcctg
cagatgggcgcacgcgatgccagccagctgtgccagcgctgcgatgccgccgacccgctg
ctgcaccacaacgcctctttcctcaccgacttccacagccaggaggagagcacctggtgg
cagagccagtccatggccttcggcatccagcatcccaactccgtcaacatcacgctccac
ctgggaaagtcctacgagatcacctacgtgcgcctgaagttccacaccagtcgccccgag
agcttcgccatttacaagcgcagccattccgatggcccctgggtgcccttccagttctac
agcgcgtcctgtgagaagacctacaggaagcggcagaggcagtacctgcggccaggtgag
gacgagcaggtggccttctgcaccgacgagttcagtgacatctccccactgagtggtggc
aacgtggctttctccaccctcgagggccgtcccagtgcctacaattttgatgggagtccc
acactgcaggagtgggtgaccgtcaccgacctgctcatctccctgaaccgcctcaatacc
tttggggatgacatcttcaaggaccccaaggtgctgcagtcgtattactatgccatctcc
gacttctctgttggcggcaggtgtaaatgcaatggtcacgccagcgagtgcgcgccggat
gaggcaggacggctggtgtgcgtgtgccagcacaacacggccggccccgactgccagcac
tgccagcccttctaccaggaccggccgtgggcgcgcggcaccgccgaggctgccaacgag
tgcctcccttgcaactgcagcggccgctcggaggaatgcttctacgacgcggagctgttc
cgccgcaccgggcacggggggcactgtcgcaactgtcgcgacaacacggccgggccccgc
tgcgagcagtgccggcagaaccactaccgctgggagcagcaggctgcctgccagccctgc
cactgccatcccgcaggttccttgcggccccagtgtgacagatcagggacctgcacctgc
aaagccaacgtgacaggttggaagtgcgagcgctgcaaggatggctaccacagcctgagc
gagggaggctgcagaccctgtgcctgtgaccctgcgggcagcgtgggcacctgtgacccc
agcactgggcattgcacctgcaaagagaaggtggaggggcacctgtgcaacaggtgccag
cccggctggttcaacctacagccccacacccccactggttgcaccagctgtttttgctat
ggccactccgccgtctgtacggcagcagatggctacgaggtgacacacatccactccgac
ttcagggaagggttggaaggctgggctgcagctgtggaagatgtggcagtgcctctgcac
tgggctgatggggagattggcactgagtgggaaaaagaggaaccactggacctccgtgca
ccggagaagtttctgcagaaccagcgtctgagctacgggcagcccctgtccctgctgctg
agaatggaagggaatggaaccagggcagagagcggggtgtttctgcttggcatccagctg
gtgctggagggtgaggggctggaggtcaccatgtccagcagtgagagccaggcacaggat
gggaagcagactgtcaccttcaggctgcatgaggcagaggagggcacagagcctttgctg
tcagccttcagcttccagcgcctgctctccaacctcaccgcccttcgcctccgtgtgagc
cgtggccccaggccaggcaggctgtggctgagccgggtgcagctcacgtcggctcgccgc
ggtgcgggaacacgggcaggatgggtggaggagtgcacgtgtccctctggctacaccggg
tccttctgtgaatcctgtgcacctggcttcaagcgggacatccccttcggtggccccttt
gtcgcctgcgtgccctgcacctgcaaccagcatggggactgcgagccactctcagggcgc
tgcagctgcttgcacaacacagagggcccctcctgcgagcgctgcagctccgggttttat
ggcaatcccttcaccgggcaacccgatgactgcaagccgtgcccgtgccctgaccgctca
ccctgcactcagctgcccagcagtggggacgtggtgtgcacccactgccccccggggcag
agaggcaagcgctgcgagctgtgcgatgatggatttttcggggaccccttggggcagaga
ggtcccgtgcgtccctgcatcccctgtcagtgtcatgggaatgtggacctcaatgccgtg
gggaactgtgattccttgtccgggcgctgcctgcgctgcctgcacaacacaacaggagag
cagtgccaccagtgtcagccggggttctatggggatgcgttggcccccagccctgctggg
aagtgtgcaccgtgcaactgcaaccctgatggctcagccttggggctggagggctgtgat
ccgggcacggggcaatgccactgcctcccacacgtgttgggcagaacctgtgagctgtgc
cagcacggctactacgggctgcaggctgccgtgggctgtaagagctgtgagtgccaccca
atggggtcccaggacagcgggtgccatgcggtgacggggcagtgctcctgccagccgggt
gtcacagggctgcgctgtgacagatgcgagcacggcttcttcggcttctcagccaggggc
tgtcgagcatgcaactgctccccgctgggctctgccagtgcgcagtgctatgagaacagc
acctgcctctgccgccccggttttgtgggctataagtgcgaccgctgccaggccaacttc
tttcctgacccaccgagctccagctgccagccgtgtcccacctgctatgggctggtgaag
gatggggtggagcggctcagagtgaagctgcaggaggtggaggaatggctgcaagaaccg
ggctgtgagctccacctggggcagccccttgagatgggagatgcaagccggggagatggg
ctgagcacacaacacctcctgcaaggtgcccatgccatgctctcagcacaggtgggacgg
ctgtcagggatgctgagcactgcacaaggccatctcagcaatgccatcagggctagtggc
tgctccagccacggacccatcaagacctgcacactgctgtcagagatcagggctgtgctg
cagtcagcacagagggaaatcctgcacgctaccaacactctggctgccacggatattccc
ctggagatccccctgctgcccaccaactggagccgcttggcaatggaggcacgggtgctg
gcagagaggcacggggatattgcagcacaggtggaggcggcagtgaggagagcgctgggt
gcctccaacaccagccatgagctcctgaggacactgctagaggggagagtggcacatgag
gcacagaaggagttggaagccgggtatgaggaaatccaacgggcatggaaggagctgggt
gctggcatggaagaggtggcagtggaagccaggagagctctcaaagccatccaggaggca
aatgtgggcatggctgagaagcttcagcaggtggctgctccagggcagcaggtgctgctg
gtgcaagctggggccctggaacaagaggtggcagcactggagcagacagtgcaggcgcag
gagccagcagcttggcagagcatcacagcatccctcagcatggcagctgggctgcgccgg
gacctgcagggcactcaaagctttgtacagctccaggaccgggctggctctgctcatgat
ctgtccacctcagcagtctcacaagggaaagcagtaatctctgatgcagagtcccttctg
ggcagcttggaaggtatgaggaaggcgctggggcatcgaaagggtcgtgctgccctgaga
aggagaatggcacaagtgcgggacagaacgatggtggaggcccagaagaagattaaacag
gcagagaaaatgctgggaaactccttgtttgtctccagcgtggccaggaagaaggcagag
gaggctgagcgtgttgctggggagagcagtaagagggctcaggctgtgctgcagggcagc
aagcaggctcgcaaggacaccaggacactcaccacacgtgtcagtgagacccagcaggag
ctgttccagcagcagcgcatggctgaggagctcagggggagcctggaggaggcagagcag
gtggggacggagatgagcaagatggcaaaaagcctgcgggaagcccggggttcactgatg
gcggacatcgagaccctgaatgatctgctggacagcctgggaggcctggagccaggcatg
caggcagaggcggtgctgggtgcagggcggctgcagctggagcagctgcggctgcggctc
agtgctccaggagccctggccacgcggctcgggcagctgcagcaggaggcagagctgcag
caggataggatccgggcgtttgagagcgacttggtggagatccgggccgacaaacagaac
ctggaggacattttgcggagcctccctgagggctgctccaagtggcaatga

DBGET integrated database retrieval system