KEGG   Meleagris gallopavo (turkey): 100541893Help
Entry
100541893         CDS       T01523                                 

Definition
histone deacetylase 7-like
Orthology
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100541893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 931 aa AA seqDB search
METSHREAEPGQQEQELRQILNKDKSKRSAVASTVVKQKLAEVILKKQQAAALERTSNPN
PPAMPYRSLEPLDPEGPSPPVLSTFLSPVPSTSLDPPEHFPLRKTASEPNLKVRCKPRKC
LDRRKNPLTRKESAPPSLKRRPPETIGDSSPSSSSTPVSGCSSPNDSLPAEHGALPTASS
MAPLAQRLMMQESSLAQFALQSAVSLPAITLGLPATTSARGDADRRPLSGLAHRVPVLNG
PVLTGTHSPMFIPAGLEQHEAGSPLSPRLQPVIILEPSVTHAPLVAVPGLGTVPFSFTPS
LISAERLSLPGHHKPLGRTRSEPLPQNPKAIQQQLVYQQHHAQFLERLKQQTHLGKRMVK
TSEKPRLRQIPSSEDMEAEGMEAGAESSEQARACVEPARPGSSGKEPERPQKMLQPQEEL
ILQQAYLWDPYQRVQHQLLKRQPLADSPMVPTILAGHRPLSRAQSSPATATVSLPAQDTT
SKALSLPVQEQTSKPHFTTGLVYDSVMLKHQCSCGDNSNHPEHAGRIQSIWSRLQERGLR
SQCECLRGRKATLEELQCVHTERHVFLYGTNPLNRLKLDNGKLAGILSQRMFVMLPCGGV
GVDSDTIWNELHSSNAARWAAGSVTELAFKVASRELKNGFAVVRPPGHHADPSTAMGFCF
FNSVAIAARQLQQKGKLNKILIVDWDVHHGNGTQQIFYRDPDVLYISLHRHDDGNFFPGS
GAADEVGAGPGEGFNVNIAWTGGLDPPMGDPEYLAAFRTVVMPIAHEFSPDVVLVSAGFD
AADGHPPPLGGYKVSAKCFGYMTKQLMSLAGGAVVLALEGGHDLTAICDASEACVSALLG
NELDPLPEESMRQKPNANAVRSLEAVIQVQSKYWVAVQRFASKLGCSFLEAQHHEAEEVE
TVTALASLSVAVMVEKRPQDEPMEEEEPMNQ
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggagacctcgcaccgtgaggcagagcctgggcagcaggagcaggagctgcggcagatc
ctcaataaggacaagagcaaacgaagtgctgtggccagcacagtggtgaagcagaaactg
gctgaggtcatcctgaagaagcagcaggcagcagctttggaaagaaccagcaaccccaac
cctccagccatgccatacagatctctggagcctctggatcctgaaggtccttcccctcct
gtactcagcaccttcctgtccccggtccctagcacttctcttgatcccccagagcatttt
ccactgcggaagacagcatctgagcccaacctgaaggtgcgttgcaagcccaggaagtgc
ctggaccgccgcaagaaccccctgacacggaaggagagcgctcccccctctctgaaaagg
agaccacctgagaccattggggattcctccccaagcagtagcagcacccctgtgtccggc
tgcagctctcccaatgacagcctccctgctgagcacggagctcttcccactgcctccagc
atggcacccctggcccagcgcctgatgatgcaggagagctccctggcccagtttgccctg
cagagtgcagtctcccttcctgccatcacactgggattgccggccaccactagtgccagg
ggagatgcggatcgtcgcccactctctggcctggcacaccgagtgcctgtgctgaatggg
cctgtcctcacgggcacacactcacccatgttcatcccagctggcttggaacagcacgag
gctgggagccccttgtcccctcggctccagcctgtcatcatcctcgagccctcagtcacc
cacgctccacttgtggcagtgccaggtctggggacagtgcccttctccttcaccccatcg
ctcatctctgcagagcgcctgtcgctcccaggccaccacaaaccactgggcaggacccgc
tcagagcccctgccccagaaccccaaagccatccagcagcagctggtgtaccagcagcac
catgcccagttcctggagaggctcaagcagcagactcacctgggcaagcgcatggtgaaa
accagcgagaagccccggctgcggcagatcccctcctcagaggacatggaggcagagggg
atggaggctggggctgagagcagcgagcaggcaagggcatgtgtggagcctgcacggccg
gggagcagcgggaaggagcctgagaggcctcagaagatgctgcagcctcaggaggagctc
atcctccagcaggcctatctctgggacccctaccagcgtgtgcagcaccagctcctcaaa
cggcagcctctggctgactcccccatggtcccaaccatcctcgcagggcacagacctctc
tccagggcccagtcatctcctgccaccgcaactgtctccctccctgctcaggatacgacc
tccaaggcgctctccctgccggtgcaggagcagaccagcaagccccatttcacaacagga
ctggtttatgactcggtgatgctcaaacaccagtgctcctgtggtgacaacagcaaccac
ccagagcacgcagggaggattcagagcatctggtctcgactgcaggagaggggtctgcgc
agccagtgcgagtgtctgcggggacgcaaggccaccctggaggagctgcagtgtgtccac
accgaacgccacgtcttcctctatggcaccaatcccctcaaccgcctgaaactggacaat
gggaagctggcagggattctgtcacagcggatgttcgtcatgctgccctgtggaggggtg
ggggtggacagtgataccatctggaatgagctgcattcctccaatgcagcccgctgggcc
gcaggcagcgtcaccgagttggccttcaaagtggccagcagggagctgaagaatggtttt
gctgtggtgcggccgcccggacatcacgcagatccatccactgccatggggttctgcttc
ttcaactcggtggccattgctgccaggcagctgcagcagaaagggaaactcaacaagatc
ctcattgtggactgggatgttcaccacggcaatgggacccagcagatcttctacagagac
cccgatgttctctacatctctttgcatcgtcacgacgatggaaacttcttccctggcagc
ggggctgctgatgaggttggtgctggccctggtgagggatttaatgtcaacatagcctgg
actggaggccttgacccccccatgggtgaccctgagtatctggcggctttcaggacggtg
gtgatgccaatcgcacatgaattctcccctgacgtggtgctggtatcagctggcttcgat
gcagctgatggccacccaccacccctgggtggctacaaagtctctgctaaatgttttggc
tacatgaccaagcagctgatgagcctggctgggggggccgtcgtcctggcactggaagga
ggccacgacctcacagccatctgtgatgcatccgaagcctgcgtgtcagccttgctgggc
aatgagctggaccctctcccagaagaaagcatgcggcagaagcccaatgccaacgccgtg
cgctccttggaagcggtgatccaggtccagagtaaatactgggtggctgtgcagcgcttc
gcctccaagctgggctgctccttcctggaggctcagcaccacgaggcagaagaggtggag
acggtcacagccctggcctccctctcagtggccgtgatggtggagaagaggccacaagat
gagcctatggaggaggaggagcccatgaaccagtga

DBGET integrated database retrieval system