KEGG   Meleagris gallopavo (turkey): 100541893Help
Entry
100541893         CDS       T01523                                 

Gene name
HDAC7
Definition
histone deacetylase 7
Orthology
K11408  
histone deacetylase 7 [EC:3.5.1.98]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100541893 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 1087 aa AA seqDB search
MHWGERETKLKGSRQLRTRAGRMSTDNKATGGWNGRAAACPALSRWFLFAALWFHAEQKD
DQSCSSVLLCSLQPERGDRDGCAGRGAAVTPCTSPRVPQAVPMDLRIGQRVVKPGSDTAL
LALKHTQQLQHQLFLASLHQQQVEQLAHQHVRVTMETSHREAEPGQQEQELRQILNKDKS
KRSAVASTVVKQKLAEVILKKQQAAALERTSNPNPPAMPYRSLEPLDPEGPSPPVLSTFL
SPVPSTSLDPPEHFPLRKTASEPNLKVRCKPRKCLDRRKNPLTRKESAPPSLKRRPPETI
DSSPSSSSTPVSGCSSPNDSLPAEHGALPTASSMAHEAPLAQRLMMQESSLAQFALQSAV
SLPAITLGLPATTSARGDADRRPLSGLAHRVPVLNGPVLTGTHSPMFIPAGLEQHEAGSP
LSPRLQPVIILEPSVTHAPLVAVPGLGTVPFSFTPSLISAERLSLPGHHKPLGRTRSEPL
PQNPKAIQQQLVYQQHHAQFLERLKQQTHLGKRMVKTSEKPRLRQIPSSEDMEAEGMEAG
AESSEQARACVEPARPGSSGKEPERPQKMLQPQEELILQQAYLWDPYQRVQHQLLKRQPL
ADSPMVPTILAGHRPLSRAQSSPATATVSLPAQDTTSKALSLPVQEQTSKPHFTTGLVYD
SVMLKHQCSCGDNSNHPEHAGRIQSIWSRLQERGLRSQCECLRGRKATLEELQCVHTERH
VFLYGTNPLNRLKLDNGKLAGILSQRMFVMLPCGGVGVDSDTIWNELHSSNAARWAAGSV
TELAFKVASRELKNGFAVVRPPGHHADPSTAMGFCFFNSVAIAARQLQQKGKLNKILIVD
WDVHHGNGTQQIFYRDPDVLYISLHRHDDGNFFPGSGAADEVGAGPGEGFNVNIAWTGGL
DPPMGDPEYLAAFRTVVMPIAHEFSPDVVLVSAGFDAADGHPPPLGGYKVSAKCFGYMTK
QLMSLAGGAVVLALEGGHDLTAICDASEACVSALLGNELDPLPEESMRQKPNANAVRSLE
AVIQVQSKYWVAVQRFASKLGCSFLEAQHHEAEEVETVTALASLSVAVMVEKRPQDEPME
EEEPMNQ
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgcactggggggaaagagagacaaagctaaagggcagcaggcagctccgcacgcgggcc
gggcggatgagcactgacaacaaagcaacgggagggtggaacggccgggctgcagcgtgc
cctgctttgagtcgctggttcctctttgccgcgctgtggtttcatgctgagcagaaggac
gaccaaagctgtagcagtgtcctgctttgttccctccagccagagcgtggggacagggac
ggctgcgcaggacggggagctgctgtgaccccgtgcacctcgccacgggtgccccaggcc
gtccccatggacctgcgcatcgggcagcgtgttgtcaagcccggctccgacacggccttg
ctggctctgaagcacacgcagcagctgcagcaccagctcttcctcgccagcctgcaccag
cagcaagtggagcagctcgcccaccagcacgtcagggtgaccatggagacctcgcaccgt
gaggcagagcctgggcagcaggagcaggagctgcggcagatcctcaataaggacaagagc
aaacgaagtgctgtggccagcacagtggtgaagcagaaactggctgaggtcatcctgaag
aagcagcaggcagcagctttggaaagaaccagcaaccccaaccctccagccatgccatac
agatctctggagcctctggatcctgaaggtccttcccctcctgtactcagcaccttcctg
tccccggtccctagcacttctcttgatcccccagagcattttccactgcggaagacagca
tctgagcccaacctgaaggtgcgttgcaagcccaggaagtgcctggaccgccgcaagaac
cccctgacacggaaggagagcgctcccccctctctgaaaaggagaccacctgagaccatt
gattcctccccaagcagtagcagcacccctgtgtccggctgcagctctcccaatgacagc
ctccctgctgagcacggagctcttcccactgcctccagcatggcccacgaggcacccctg
gcccagcgcctgatgatgcaggagagctccctggcccagtttgccctgcagagtgcagtc
tcccttcctgccatcacactgggattgccggccaccactagtgccaggggagatgcggat
cgtcgcccactctctggcctggcacaccgagtgcctgtgctgaatgggcctgtcctcacg
ggcacacactcacccatgttcatcccagctggcttggaacagcacgaggctgggagcccc
ttgtcccctcggctccagcctgtcatcatcctcgagccctcagtcacccacgctccactt
gtggcagtgccaggtctggggacagtgcccttctccttcaccccatcgctcatctctgca
gagcgcctgtcgctcccaggccaccacaaaccactgggcaggacccgctcagagcccctg
ccccagaaccccaaagccatccagcagcagctggtgtaccagcagcaccatgcccagttc
ctggagaggctcaagcagcagactcacctgggcaagcgcatggtgaaaaccagcgagaag
ccccggctgcggcagatcccctcctcagaggacatggaggcagaggggatggaggctggg
gctgagagcagcgagcaggcaagggcatgtgtggagcctgcacggccggggagcagcggg
aaggagcctgagaggcctcagaagatgctgcagcctcaggaggagctcatcctccagcag
gcctatctctgggacccctaccagcgtgtgcagcaccagctcctcaaacggcagcccctg
gctgactcccccatggtcccaaccatcctcgcagggcacagacctctctccagggcccag
tcatctcctgccaccgcaactgtctccctccctgctcaggatacgacctccaaggcgctc
tccctgccggtgcaggagcagaccagcaagccccatttcacaacaggactggtttatgac
tcggtgatgctcaaacaccagtgctcctgtggtgacaacagcaaccacccagagcacgca
gggaggattcagagcatctggtctcgactgcaggagaggggtctgcgcagccagtgcgag
tgtctgcggggacgcaaggccaccctggaggagctgcagtgtgtccacaccgaacgccac
gtcttcctctatggcaccaatcccctcaaccgcctgaaactggacaatgggaagctggca
gggattctgtcacagcggatgttcgtcatgctgccctgtggaggggtgggggtggacagt
gataccatctggaatgagctgcattcctccaatgcagcccgctgggccgcaggcagcgtc
accgagttggccttcaaagtggccagcagggagctgaagaatggttttgctgtggtgcgg
ccgcccggacatcacgcagatccatccactgccatggggttctgcttcttcaactcggtg
gccattgctgccaggcagctgcagcagaaagggaaactcaacaagatcctcattgtggac
tgggatgttcaccacggcaatgggacccagcagatcttctacagagaccccgatgttctc
tacatctctttgcatcgtcacgacgatggaaacttcttccctggcagcggggctgctgat
gaggttggtgctggccctggtgagggatttaatgtcaacatagcctggactggaggcctt
gacccccccatgggtgaccctgagtatctggcggctttcaggacggtggtgatgccaatc
gcacatgaattctcccctgacgtggtgctggtatcagctggcttcgatgcagctgatggc
cacccaccacccctgggtggctacaaagtctctgctaaatgttttggctacatgaccaag
cagctgatgagcctggctgggggggccgtcgtcctggcactggaaggaggccacgacctc
acagccatctgtgatgcatccgaagcctgcgtgtcagccttgctgggcaatgagctggac
cctctcccagaagaaagcatgcggcagaagcccaatgccaacgccgtgcgctccttggaa
gcggtgatccaggtccagagtaaatactgggtggctgtgcagcgcttcgcctccaagctg
ggctgctccttcctggaggctcagcaccacgaggcagaagaggtggagacggtcacagcc
ctggcctccctctcagtggccgtgatggtggagaagaggccacaagatgagcctatggag
gaggaggagcccatgaaccagtga

DBGET integrated database retrieval system