KEGG   Meleagris gallopavo (turkey): 100541896Help
Entry
100541896         CDS       T01523                                 

Definition
histone H2B 8-like
Orthology
K11252  
histone H2B
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKTQKKGDKKRRKTRKESYSIYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaccagcgaagtcggctcctgcccccaagaagggctccaaaaaggcggtcacc
aagacccagaagaagggtgacaagaaacgtagaaagacaaggaaagagagctactcgatc
tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggtatctcgtccaaggccatg
ggtatcatgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcgtcgcgc
ctggcgcactacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcgg
ctgctgctgcccggcgagctggccaagcacgcggtctcggagggcaccaaggcggttacc
aagtacaccagctccaagtag

DBGET integrated database retrieval system