KEGG   Meleagris gallopavo (turkey): 100541896Help
Entry
100541896         CDS       T01523                                 

Definition
histone H2B 8-like
Orthology
K11252  
histone H2B
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100541896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 164 aa AA seqDB search
MERDNFESLNLHTASISTGDGAIVPASIQRYRQRRACAMPEPAKSAPAPKKGSKKAVTKT
QKKGDKKRRKTRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggacaacttcgagtcccttaatttgcataccgcctctataagtacgggcgac
ggcgccattgtacctgcgtcgatccagcggtataggcagcggcgggcgtgcgcgatgccg
gaaccagcgaagtcggctcctgcccccaagaagggctccaaaaaggcggtcaccaagacc
cagaagaagggtgacaagaaacgtagaaagacaaggaaagagagctactcgatctacgtg
tacaaggtgctgaagcaggtgcaccccgacacgggtatctcgtccaaggccatgggtatc
atgaactcgttcgtcaacgacatcttcgagcgcatcgccggcgaggcgtcgcgcctggcg
cactacaacaagcgctcgaccatcacgtcgcgggagatccagacggccgtgcggctgctg
ctgcccggcgagctggccaagcacgcggtctcggagggcaccaaggcggttaccaagtac
accagctccaagtag

DBGET integrated database retrieval system