KEGG   Meleagris gallopavo (turkey): 100541940Help
Entry
100541940         CDS       T01523                                 

Gene name
USP32
Definition
ubiquitin specific peptidase 32
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100541940 (USP32)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100541940 (USP32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
21
AA seq 1561 aa AA seqDB search
MVILKYFLMKFNVIYCSFGGISKGLHFNNLIVGLVLLTRGKEEEKTKYIFSLFSNESGSY
VVRDEMEKMLHVVDGKVPESLKKCFSEGEKVNYEKFRIWLLHNKDAFTFSRWLLSGGVYV
TLTDDSDTPTFYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFAPLVSPPIHP
SLSEGLFNAFDENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDIDRDGVLSRTELK
EMMVALLEVWKDNRTDKIPELDMDLSEIVEDILNMHDNTKLGHLTLEDYQIWSVKSALAN
EFLNLLFQVCHIVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFLIAMPWWHQWKEY
VKYDANPVVIEPSSVLSGGKNSLIAAAANTSEQGEDKMGGLNYFSATEEKFSDNISTASE
ASETTSSNALYPSTPGTDVCIARQHNTSDNNNQCFLGTNGNTLLQLNPQKPGAIDNQPLV
TQEPVKAASLTMEGGRLKRSPQLVEGRDYVMVPEPVWRALYHWYGANLSLPRPVIKNSKT
NVPELELFPRYLLFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKE
IHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHRLEYLKIQDEQHLVIEVRNKDMSWP
EEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTRYFISGRHLYE
LNRTNPIGMKGHMAKCYGDLVQELWSGTQKNIAPLKLRWTIAKYAPRFNGFQQQDSQELL
AFLLDGLHEDLNRVHDKPYVELKDSDGRPDWEVAAEAWENHLRRNRSIVVDLFHGQLKSQ
VKCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPVRYGLRLNMDEKYTGLK
KQLSELCGLKPEQILLAEVHSSNIKNFPQDNQKVRLSVSGFLCAFEIPVPGSPTSASSPV
QSDISTGSSANGAPNVMMNGDLPKPTLIPNGMPNTVVPCGTERNLANWTLNGHVPVLSDS
PCTGYIIAVHRKMMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLA
SPLPPQEASNHAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIECTEDRASV
GNAYIAVDWDPTALHLRYQTSQERIVEEHESVEQSRRAQAEPINLDSCLRAFTSEEELGE
DEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRENFDPSA
FLVQRDPSHFQRKQLTPQIDEIPEARTLQGDSKKVDLQITYSTEGDVNRSPSSLNTANVM
NNIKASPSLGRKSGTSCPSSKSSSPNSSPRTLGRGKGRLRLPQLGKNKLSSSKENLDGSK
ENCTDQEQKIASDRSDTLTRGQNLGGSQNELYTELYTAQDNEVTLANGYICEQNAYSNGS
INGQIDNHSEEDIADDQREEVCVNPIYNLYAISCHSGIMGGGHYVTYAKNPNNKWYCYND
SSCKELHPDEIDTDSAYILFYEQQGVDYAQFLPKIDGKKMADTSSMDEDFESDYKKYCVL
Q
NT seq 4686 nt NT seq  +upstreamnt  +downstreamnt
atggtgattcttaagtactttctcatgaaatttaatgttatctactgttcatttggagga
atatccaaagggctgcacttcaataacttgatagttggattagttctactcactagaggc
aaagaggaggagaaaacaaaatacattttcagtctcttttctaatgaatctgggagttat
gtggttcgtgatgagatggaaaagatgctgcatgttgttgatgggaaagtcccagagtct
ctcaagaaatgtttctctgagggtgaaaaggtaaactatgagaagttcaggatttggctg
ttgcacaacaaagatgctttcacgttttcccgttggctgctgtctggaggtgtgtatgtg
acactcactgatgatagtgacactcctaccttctatcaaaccctggctggagtcacacac
ttggaagaatctgacatcattgatcttgagaaacggtactggctgctaaaagctcaatca
agaactggacgctttgatttagaaacatttgctcccttggtttcccctcctattcatcca
tctctgagtgaaggtttgtttaatgcctttgatgaaaaccgagacaatcacatagatttt
aaagaaatttcctgtgggctctcagcatgttgcaggggacccctggcagaaaggcagaag
ttttgcttcaaggtttttgacattgatcgggatggtgtgctgtctcgcacagaacttaaa
gaaatgatggttgcgcttttagaggtctggaaagataaccgtactgataaaatacctgag
ttggacatggatttatctgaaattgtagaagatattttgaatatgcatgacaacacaaag
cttggacacctcactctcgaggactaccagatatggagtgtgaagagtgctcttgccaat
gagtttttaaatctactttttcaggtgtgtcatatagttttggggctgcgacctgccact
ccagaagaggaaggacagattattagaggctggctggaaagggaaagcagatatggcctt
cagccagggcacaactggtttcttattgcaatgccgtggtggcaccagtggaaagaatat
gtcaaatatgatgcaaaccctgttgtgatagagccttcatctgtcttgagtggaggtaag
aattcactcatagctgctgcagccaatacttcagaacagggagaagacaaaatgggaggt
cttaattacttcagtgcaacagaagaaaagttttcagataatatttctactgcatcagaa
gcctcagagactactagcagcaatgctctttatcccagcacaccagggacggatgtgtgt
attgctaggcagcataacacttcggacaataataatcagtgtttccttggaaccaatggg
aatactttgcttcagctcaatcctcagaaaccaggagctattgataaccaaccccttgta
acacaagaaccagtgaaggctgcatcgttaacaatggagggtggaagattaaagcgatcg
ccgcagctggtcgaaggaagggactacgtcatggtgccagaaccagtttggagagcactt
taccattggtatggagcaaacctgtccttgcccaggccggtgatcaaaaacagcaagaca
aatgtgcctgaactggagttatttcctcgctatctgctctttctgagacagcagcctgcc
acgcgaacgcagcagtcaaacatctgggtgaatatgggaaatgtaccttcaccgaatgct
cctttaaaaagagtgctggcttacactggctgcttcagtcgaatgcaaacaattaaagag
atacatgaatatctctcccagaggctgcgtataaaggaagaagatatgcgcctctggttg
tacaacagtgagaactaccttactttgctggatgatgaagaccacagactggaatatctt
aaaatccaagatgaacagcatctagtaatagaagttcgaaacaaagacatgagctggcct
gaagagatgtcttttatcgcaaacagcagtaaaatagacagacacaaagttcctactgag
aagggtgctactggattaagtaatctgggtaacacgtgtttcatgaactccagtatccag
tgtgtcagtaatacgcaacctctgacgcggtatttcatctcaggaagacatctttatgaa
cttaacaggacaaatccaataggaatgaaaggacacatggccaaatgctatggggattta
gttcaggagttgtggagtgggactcagaagaatatagcaccactgaagttgcggtggaca
atagcaaaatatgctccaaggtttaatggctttcaacaacaagactcgcaggagcttctg
gcttttcttttggatggtcttcatgaggatttgaatagagttcatgataagccatatgtt
gaactgaaagatagcgatggtcggccagactgggaagtagcagctgaggcctgggaaaac
catctgagaagaaacagatcaattgtcgtagatttatttcatgggcagctgaaatcacaa
gtgaaatgtaaaacttgtggacacataagcgttcggtttgatcctttcaattttttatcc
ttacctttgcccatggatagctacatgcacctagaaattacagtaatcaaactggatggt
actactcccgttcgatacggcctgagattgaacatggatgaaaaatatacgggtttgaaa
aaacagttaagtgaactctgtggactaaaaccagaacagatactacttgcagaagtgcac
agttccaatataaagaattttcctcaggacaaccagaaagtccggttatcagtgagcggc
tttttgtgtgcgtttgaaataccagttccaggatcacctacatcagcatcaagtcctgtg
cagtcagatatctcaactggatcatcagctaatggagcacccaacgtaatgatgaatggg
gatcttcccaaaccaaccctgattccaaatggaatgccaaatactgtagtgccatgtgga
acagaacgtaaccttgccaactggactctcaatggtcacgtgcctgtgctttctgatagt
ccatgcacagggtacataattgcagtccacagaaaaatgatgcggacagaactatatttt
ctttcatctcagaagaatcgtcccagtctctttggaatgccactaattgttccttgcaca
gttcacacacggaaaaaagatctgtatgatgcagtatggattcaggtttccaggcttgcc
agccccctgccccctcaggaagctagtaatcatgcacaagactgtgatgacagcatggga
tatcagtatccattcaccctaagagtggttcagaaggatggaaattcttgtgcttggtgt
ccgtggtacagattttgtcgtggctgtaaaattgagtgcacagaggatagagcttctgtt
gggaatgcttacattgctgtagactgggatccaacagcactccatctacgctaccagaca
tcccaggaacggattgtagaagagcatgaaagtgttgaacaaagccgccgagctcaagca
gagcccatcaacctggatagttgtcttagagccttcaccagtgaagaagaactgggtgaa
gatgagatgtactactgttccaaatgcaagacccattgtttggctacaaaaaaactagat
ctctggaggcttcctcccattttgatcattcacctgaaaagatttcagtttgtaaatggc
cgctggataaaatctcagaaaattgttaaatttcctcgagaaaattttgacccaagtgcc
tttttggtacaaagggatccaagtcattttcagagaaaacagttaactcctcaaattgat
gaaattcctgaagcacggactcttcaaggggactctaaaaaagtagatctgcagatcact
tattcaactgaaggagatgtgaacagaagtccatcatcccttaacactgctaatgtcatg
aataatatcaaagcatctccatctctgggaaggaagagtggaaccagctgtccttcgagt
aagagcagtagcccaaacagtagcccaaggactttaggaagaggcaaagggcgcctgcgg
ctaccgcaactgggcaaaaacaaactgtcaagtagcaaagaaaacttggatggaagtaaa
gaaaactgcactgaccaggaacagaaaattgcttctgatcgaagtgatactcttacgagg
gggcagaatttgggtggtagtcagaatgaactgtatactgaactgtatactgctcaggac
aatgaggtgactctagccaacggatacatctgtgaacagaacgcgtatagtaacggtagt
atcaacggccagattgacaaccacagcgaggaggatattgcagatgaccaaagagaagaa
gtttgtgttaaccctatttacaatctatatgcaatttcgtgccattcaggaattatggga
gggggtcattatgtcacttatgccaaaaacccaaacaacaagtggtactgctacaatgac
agtagctgtaaggaattgcatcctgatgaaattgacaccgactctgcctacattcttttc
tatgagcagcagggggtagactatgcacaatttctgccaaagattgatggcaaaaagatg
gcagacacaagcagcatggatgaagactttgagtcagattataagaagtactgtgttcta
cagtaa

DBGET integrated database retrieval system