KEGG   Meleagris gallopavo (turkey): 100541966Help
Entry
100541966         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase CYLD-like
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100541966
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100541966
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C67
   100541966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 322 aa AA seqDB search
MAGVELDEDKGVTAGEWLGKYYFHCAPKRGIFVKLQSCQPDVRFQCSRNCDLSLVGYREK
EDVPHVPLSFPPLRNEEAVHILRGRMKGIQGHCNSCYMDAALFSLFSCTSVLDSMLFTPF
PLCDRNVQNILRDEIVNPLRKNGFVMARSVMHLREQLTEKGQCSSFTSAEKDPEEFLNLI
MHQVLGIEPLLRLQSGAQKEQDCYCYQIFMDKQEDLVVPDVQQLVEHSFLSSDLKLVEIP
SCFIIQMPRFGKEYKMFSKIIPSLELDITDLLLDSPRECCVCSDVATWECSKCFKDKIFS
PTGLKQFCSTCSKQVLSSFGCS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagttgaactggatgaagataaaggagtcactgctggcgaatggctgggtaaa
tactatttccactgtgctcccaagcgtggcatctttgtgaagctgcagtcctgccagccc
gacgttcgcttccagtgctcgcgcaactgcgacctgagcctcgtaggatatagagagaag
gaagatgttccccacgttccgctcagttttcctcctctaaggaatgaagaagcggtgcac
atcctacgaggacggatgaaggggatccagggccactgcaattcctgctacatggatgca
gcactctttagcctcttctcctgtacatccgtgctggactccatgctcttcacacccttc
ccattgtgtgataggaatgtccagaacattctgcgggatgagatcgtgaacccgctccga
aagaatggctttgtaatggctaggagtgtgatgcacctgagggagcagctaactgagaag
ggccaatgctcaagctttaccagtgcagagaaagatccggaggagttcctgaacctcata
atgcatcaggtcctgggaatagagccactcttgagactgcagtcaggagcccagaaggag
caggactgctactgctaccaaatatttatggacaaacaggaggacctagtggttcctgat
gtgcagcagttggtggaacactccttcctgtcttcagatctgaagctagtagagatccca
tcttgcttcattattcaaatgccacgatttgggaaggaatataaaatgttcagcaagatc
atcccttccttagagctggatatcaccgatctgctgctggacagtcccagagagtgctgt
gtgtgcagtgacgttgccacctgggagtgttcaaagtgtttcaaagacaaaatattctca
cctacgggtctgaagcagttctgcagcacctgctccaaacaggtattaagttcctttggg
tgctcatga

DBGET integrated database retrieval system