KEGG   Meleagris gallopavo (turkey): 100541989Help
Entry
100541989         CDS       T01523                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100541989 (POMT1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     100541989 (POMT1)
Glycosyltransferases [BR:mgp01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   100541989 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 726 aa AA seqDB search
MLGFLKKPVVVTAEINLNLVVLTVMGLMSRLWGLSYPRAVVFDEVYYGQFVSLYMKRIFF
VDDSGPPLGHMLLALGGYLGGFDGNFLWNRIGAEYSTNVPVCSLRFLPALAGALCIPLAY
QILVELQFSHCAALGAALLILLENSLITQSRFMLLESILIFFILLAVLSYLKFYNLQRHS
SFSGRWWFWLLLTGVACSCAVGVKYMGLFTYMLLLAIAGLHFWHMLGDRNLSNVSLVCHF
LARGLSLLIIPVAMYLSFFYVHLTLLYRSGPHDQIMTSAFQASLEGGLARITQGQPLEVA
YGSQITLRNVLGKPMQCWLHSHTNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
MQQLVVSNPPRPVRHGHVVQLVHGITTRYLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRVEIVNRESDTDVWKTILSEVRFVHVNTSAVLKLSGASLPEWGYRQLEVVGEKLSKGY
HQSMVWNVEEHRYGKSQEQKEREVELHSPTRMDISKNLSFMAKFTELQWKILTLKNEDTE
HKYSSSALDWITMDTNIAYWLHPTSGAQIHLLGNVCTWNSANIAAVVYTCLSLWYLIRRR
RKIYDIPEDAWQLWASAGQICVGGWVVNYLPFFLMEKTLFLYHYLPALTFQILLIPIVLQ
HLSDHLCRSLLSKSMFSALIVAWFSSVCFAYRTFSPVTYGEPLSVAELKDLRWKDSWNIL
IRKQGH
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgttgggatttctgaagaagccagttgtggttactgcagagataaatctcaaccttgtg
gtgctgactgtcatgggattaatgagccgtctatgggggctttcctatccacgtgctgtt
gtttttgatgaagtttattatggccaattcgtttccctctacatgaagagaatcttcttt
gtggatgacagtggcccgccgcttggccatatgctgctagctttgggaggttacttagga
ggatttgatggaaacttcttatggaacaggattggagctgaatatagcacaaacgttcct
gtgtgctccttgcgcttcctgccagcactggctggtgctctctgcatccccttggcatac
cagattttggtagagctgcagttctcccactgtgctgcccttggagctgctcttctgatt
ctcttagagaactctctgatcactcagtcaaggttcatgcttctggaatccatattgatt
ttttttatcctgcttgcagttttgtcctacctgaagttctacaatttgcagaggcacagt
tccttctccggaaggtggtggttctggcttctgttgactggagtagcttgttcttgtgct
gttggagtgaaatacatgggcctgtttacctacatgctgctcctggccattgcaggactc
cacttctggcacatgttaggagaccggaacttgtcaaatgtttccttggtgtgccatttt
ctagctaggggactgagcctcctcatcatcccagtggccatgtacctgtccttcttctat
gtccacttgactttgctgtatcgctctgggcctcacgaccagattatgacaagtgctttc
caagccagcttagagggtgggctggctcgaatcactcagggccagcccttagaggtggcc
tatggctctcagatcactctgcggaacgtgctgggcaagcccatgcagtgttggctccat
tctcacacgaatacttaccccatcaggtatgagaatggccgaggtagttctcatcagcaa
caggtgacctgttatccctttaaggatgtgaacaactggtggattgtcaaagatcctgga
atgcagcagctggtggtgagtaacccaccccgtcctgtcagacatgggcacgtcgtgcag
ctggtccatggcatcacaactcggtacctcaacacgcacgatgttgctgcccctcttagc
ccccactcccaagaagtttcctgctatattgattataacatttccatgccagcacagaac
ctctggagagtggaaattgtaaaccgtgagtctgacacagatgtgtggaaaaccattctg
tcagaagtgaggtttgttcacgtgaatacctctgcagtgctgaagctcagtggagcatct
ttacctgagtggggataccggcagctggaggtggttggagagaagctgtccaaaggctac
caccagagcatggtgtggaatgtggaagagcacagatatgggaaaagccaagagcaaaaa
gagagggaagtggaactccactctcccacgcggatggatataagtaaaaacctaagcttc
atggcaaagttcacagaattgcagtggaagatactcacattgaaaaatgaagacacagaa
cataagtacagctcctctgctcttgattggatcacaatggacacaaatattgcatactgg
ctacacccaacctctggtgcccagatccatctccttgggaatgtttgcacctggaattca
gctaacatcgctgctgtggtctacacgtgtctgtccctgtggtacttgatacgacgaaga
agaaaaatttatgatattcctgaagatgcatggcagctgtgggcatcagctgggcagatc
tgtgttggaggttgggttgtgaattacctgcctttctttctgatggagaagacacttttc
ctataccactatttgcctgccctcacattccagattctcctgattcccatcgtattacag
catctcagcgatcatctctgcagatctctgctttccaagagcatgttcagtgcactgatt
gtagcctggttctcctcagtgtgctttgcctatcgcacgttcagccctgtgacctacggg
gagcccctgtctgttgctgagctcaaggacctgcgctggaaggacagctggaacatcctc
atccgaaaacagggacactga

DBGET integrated database retrieval system