KEGG   Meleagris gallopavo (turkey): 100542008Help
Entry
100542008         CDS       T01523                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100542008
Transfer RNA biogenesis [BR:mgp03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100542008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 534 aa AA seqDB search
MGQKRKDLSHAELMMMTIADIIKQLIEAHEQGKDVNLNKLKTKTSAKYXXXXXXHRKALV
PKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPDSDFEYSTQSYTGYEPT
SMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALPEDYRDYFIRNLHDAL
SGHTSNNVAEAVKYSERSLTKCVGITIETRPDYCLKRHLSDMLSYGCTRLEIGVQSVYED
VARDTNRGHTVKAVCESFHLAKDAGFKVVAHMMPDLPNMGLERDIDQFVEFFENPAFRPD
GMKLYPTLVIRGTGLYELWKTGRYKSYPPSTLVDLVARILALVPPWTRVYRVQRDIPMPL
VSSGVEHGNLRELALARMKDLGTQCRDVRTREVGIQEIHHKVRPYQIELIRRDYVANGGW
ETFLSYEDPEQDILIGLLRLRKCSEESFRPELKGGVSIVRELHVYGSVVPVSSRDPSKFQ
HQGFGMLLMEEAERIAKEEHGSWKIAVISGVGTRNYYRKIGYELEGPYMVKRLQ
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggggcagaagcggaaagatctcagccatgcagagctgatgatgatgacaatagctgac
atcataaaacagttaattgaggctcacgagcaaggaaaagatgtgaatctgaacaagctg
aaaaccaagacctcagcaaagtatnnnnnnnnnnnnnnnnnncaccgcaaggctctggtg
ccaaagctgaaggccaagcccataaggacagctagtgggattgctgtcgtggctgtgatg
tgcaaaccacacaggtgtccacacattaacttcacaggcaacatatgtgtatactgccca
ggtggccctgattctgattttgaatattcaacgcagtcttacactggatatgagcctaca
tccatgagggccattcgggctcggtatgacccttatctccagacaagacatagagtggaa
cagctgaagcagttgggtcacagcgtggataaagtggagttcattgtgatgggtggaact
ttcatggccttgcctgaagactacagggattacttcatccgaaaccttcacgacgcgctg
tcgggtcacacctccaataacgtagcagaggctgtcaagtattctgaacgaagcttgacc
aaatgcgttgggataaccatcgagaccagaccagattactgcctgaagcgccatttgagc
gacatgctgtcctatggctgcacgaggctggagatcggagtgcagagtgtgtatgaggac
gtggccagggacaccaacagaggtcacaccgtgaaggctgtgtgcgagtcgttccacttg
gccaaggatgctggcttcaaagtggtggcacacatgatgcctgatttaccaaacatgggg
cttgaaagggacatcgaccaatttgttgagttctttgagaacccggcttttcgccccgat
ggcatgaagctctacccaacgctggtgatccgcggcaccgggctgtacgagctctggaag
actggcagatacaagagctacccccctagcactcttgtggatctcgtggccagaatcctg
gctctggtcccaccatggactcgtgtgtaccgtgttcagagagacatcccaatgccactg
gtgagctctggagtggagcatgggaacctgagggagcttgccttggccaggatgaaagat
cttgggacacagtgtcgtgatgtaaggacaagagaggttggaattcaagaaattcaccat
aaagtgagaccatatcagattgaattaattagaagagattatgtggctaatggtggctgg
gagaccttcctgtcctacgaagacccagagcaggacattctcattggcctcctacgactg
cgaaagtgctcagaagagtctttcagacctgagctaaaggggggtgtttccattgtgaga
gagctgcacgtgtatgggagcgtggtcccagtgagcagtcgggatccttccaaatttcag
caccagggatttggcatgctactcatggaggaggcagaaagaatagccaaggaggaacac
gggtcatggaaaattgctgtaatttcaggcgttggcacgaggaactactacaggaagatt
ggctacgagctggaagggccgtacatggtgaaaaggctgcagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system