KEGG   Meleagris gallopavo (turkey): 100542010Help
Entry
100542010         CDS       T01523                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100542010 (PDGFRA)
   04020 Calcium signaling pathway
    100542010 (PDGFRA)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100542010 (PDGFRA)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100542010 (PDGFRA)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100542010 (PDGFRA)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100542010 (PDGFRA)
   04540 Gap junction
    100542010 (PDGFRA)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100542010 (PDGFRA)
Protein kinases [BR:mgp01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   100542010 (PDGFRA)
Enzyme-linked receptors [BR:mgp01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   100542010 (PDGFRA)
Cytokine receptors [BR:mgp04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   100542010 (PDGFRA)
Cellular antigens [BR:mgp04090]
 Proteins
  100542010 (PDGFRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 903 aa AA seqDB search
MGTPPRTFLILGCFLTGPILTLCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGMYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSLPEDQFILVEEGDPTVIPCRTSDPSAEVTLVNSLDKPVYAFYDSKQGFVG
NFLAGPYTCKTMVKGMEFKSDEFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPDASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSVLKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALILDL
MDDHQGSAGRQTVRCLAEGTPLPDVEWLVCKDIKKCSNDSSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSLSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGMYCEHFLT
CCN
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgggtactcccccaaggacgttcctgatcctgggatgttttctcacaggaccgatccta
acactttgccagcttcctctgccgactattgttcccaacagaaatgagatggttgtacag
ctgaattccaatttcacactcaaatgctctggagacagcgaagtgagctggcagtacccg
gtgactgagggaagccacaggatagacatcaggcacgaggagaacaacagtggcctcttc
gtgacagtgctcgaagtcggaaatgcctcagccgctcacacgggcatgtacgtttgctat
tataaccacacgcaagtggaggatggggaagttgaggggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttccttaccagaagaccagttcatcctagtagaa
gaaggtgatcccaccgttatcccttgtcggacaagtgacccaagcgctgaagtgacttta
gttaacagtttagacaagcctgtctatgctttctatgacagcaaacagggcttcgtaggg
aatttccttgcaggaccatatacatgcaaaacaatggttaaaggcatggagttcaagtcc
gatgagttcctcatctatattttaagagctacttcacagctgccggttgaaattgaagct
ctgaagactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcccgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcgcagaagttggtttacacgttgaccattcctgacgca
tcagtgaaagacacaggggattatgaatgtactgctcgacatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaagggttcattcatctagagcctcag
tttagccctttggaagctgtcaatctacatgaagtcaaaaattttgtcgtcgatgtgcag
gcgtaccccgctccaaaaatgtactggttgaaggataatgtgactctgattgaaaatctt
actgagattgttactagttcaaacagggtccaggaaacacggtttcaaagtgtactaaaa
ttgatccgggccaaggaagaagacagtgggtactatactttggttgctgaaaatgaagat
gagattaagagatacaccttctcgttactaattcaagttccagccttgattttagacctc
atggatgaccaccaaggctctgctggcaggcagacagtgaggtgcttggctgaagggacc
ccgcttcctgatgtggaatggctggtttgcaaggacattaaaaaatgcagcaatgactct
tcctggactcttctgactaacaatatctctgatatacacatggaagcccacctggatgag
aagaatatggtagaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgaga
tgtgtagcaagaaacgaccttggtgctgttactcgggaactgaaacttgtggctcccacc
ttgcgatcagaactgacggtggctgctgccgtcttagtactgttggtgattgtgataatt
tcactgattgtcctggtcatcatctggaaacagaagccaaggtatgagataagatggaga
gtcattgagtctatcagccctgatgggcatgaatacatttatgtggacccaatgcagcta
ccgtatgactccagatgggagtttcctcgagatgggttagtgcttggtcgaatccttggt
tctggtgcattcggaaaagtggtggaagggacagcatatggactgagtcgttctcaacca
gtgatgaaagtagctgtgaaaatgctgaaacctacggctagatccagtgaaaaacaggca
ctcatgtctgaactgaagataatgacacatcttgggccccatctgaatattgtgaacctg
cttggagcttgtacaaaatcaggtcctatttacataatcactgaatactgcttttatggt
gatttggtgaactatctgcacaagaacagggacaacttcctcagccgacatccagagaaa
ccaaagaaagatctggatatttttgggatgaacccagctgatgaaagcacaagaagctat
gtgattttatcatttgaaaacactggagaatacatggacatgaaacaagctgatacaact
cagtacgtgccaatgctggaaaggaaagagggatctaaatactctgacattcagagatct
gtatatgatcgacctgcttcatataagaagaaatctttgtcagaatcagaagtaaaaaac
cttctttcagatgacagttcagagggtctgagcctactggatttgctaagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgtgtacaccgtgacttggca
gctcgtaatgtccttctggctcaaggcaaaatcgtgaagatctgtgactttgggttggct
agagacatcatgcatgattccaactacgtctccaagggcagcactttccttccagtaaaa
tggatggcacctgaaagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggtattctgctgtgggaaatattttctcttggtatgtactgtgaacactttcttaca
tgttgtaattaa

DBGET integrated database retrieval system