KEGG   Meleagris gallopavo (turkey): 100542010Help
Entry
100542010         CDS       T01523                                 

Definition
alpha-type platelet-derived growth factor receptor-like
Orthology
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mgp04010]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mgp04020]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:mgp04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:mgp04144]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mgp04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mgp04510]
Cellular Processes; Cell communication; Gap junction [PATH:mgp04540]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 1087 aa AA seqDB search
MGTPPRTFLILGCFLTGPILTLCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGMYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSLPEDQFILVEEGDPTVIPCRTSDPSAEVTLVNSLDKPVYAFYDSKQGFVG
NFLAGPYTCKTMVKGMEFKSDEFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPDASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSVLKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALILDL
MDDHQGSAGRQTVRCLAEGTPLPDVEWLVCKDIKKCSNDSSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSLSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgggtactcccccaaggacgttcctgatcctgggatgttttctcacaggaccgatccta
acactttgccagcttcctctgccgactattgttcccaacagaaatgagatggttgtacag
ctgaattccaatttcacactcaaatgctctggagacagcgaagtgagctggcagtacccg
gtgactgagggaagccacaggatagacatcaggcacgaggagaacaacagtggcctcttc
gtgacagtgctcgaagtcggaaatgcctcagccgctcacacgggcatgtacgtttgctat
tataaccacacgcaagtggaggatggggaagttgaggggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttccttaccagaagaccagttcatcctagtagaa
gaaggtgatcccaccgttatcccttgtcggacaagtgacccaagcgctgaagtgacttta
gttaacagtttagacaagcctgtctatgctttctatgacagcaaacagggcttcgtaggg
aatttccttgcaggaccatatacatgcaaaacaatggttaaaggcatggagttcaagtcc
gatgagttcctcatctatattttaagagctacttcacagctgccggttgaaattgaagct
ctgaagactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcccgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcgcagaagttggtttacacgttgaccattcctgacgca
tcagtgaaagacacaggggattatgaatgtactgctcgacatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaagggttcattcatctagagcctcag
tttagccctttggaagctgtcaatctacatgaagtcaaaaattttgtcgtcgatgtgcag
gcgtaccccgctccaaaaatgtactggttgaaggataatgtgactctgattgaaaatctt
actgagattgttactagttcaaacagggtccaggaaacacggtttcaaagtgtactaaaa
ttgatccgggccaaggaagaagacagtgggtactatactttggttgctgaaaatgaagat
gagattaagagatacaccttctcgttactaattcaagttccagccttgattttagacctc
atggatgaccaccaaggctctgctggcaggcagacagtgaggtgcttggctgaagggacc
ccgcttcctgatgtggaatggctggtttgcaaggacattaaaaaatgcagcaatgactct
tcctggactcttctgactaacaatatctctgatatacacatggaagcccacctggatgag
aagaatatggtagaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgaga
tgtgtagcaagaaacgaccttggtgctgttactcgggaactgaaacttgtggctcccacc
ttgcgatcagaactgacggtggctgctgccgtcttagtactgttggtgattgtgataatt
tcactgattgtcctggtcatcatctggaaacagaagccaaggtatgagataagatggaga
gtcattgagtctatcagccctgatgggcatgaatacatttatgtggacccaatgcagcta
ccgtatgactccagatgggagtttcctcgagatgggttagtgcttggtcgaatccttggt
tctggtgcattcggaaaagtggtggaagggacagcatatggactgagtcgttctcaacca
gtgatgaaagtagctgtgaaaatgctgaaacctacggctagatccagtgaaaaacaggca
ctcatgtctgaactgaagataatgacacatcttgggccccatctgaatattgtgaacctg
cttggagcttgtacaaaatcaggtcctatttacataatcactgaatactgcttttatggt
gatttggtgaactatctgcacaagaacagggacaacttcctcagccgacatccagagaaa
ccaaagaaagatctggatatttttgggatgaacccagctgatgaaagcacaagaagctat
gtgattttatcatttgaaaacactggagaatacatggacatgaaacaagctgatacaact
cagtacgtgccaatgctggaaaggaaagagggatctaaatactctgacattcagagatct
gtatatgatcgacctgcttcatataagaagaaatctttgtcagaatcagaagtaaaaaac
cttctttcagatgacagttcagagggtctgagcctactggatttgctaagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgtgtacaccgtgacttggca
gctcgtaatgtccttctggctcaaggcaaaatcgtgaagatctgtgactttgggttggct
agagacatcatgcatgattccaactacgtctccaagggcagcactttccttccagtaaaa
tggatggcacctgaaagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggtattctgctgtgggaaatattttctcttggtggcacaccatatcctggcatgatg
gttgactccactttctacaataagataaagagtggctaccgaatggcaaaacctgatcat
gcaaccaatgaagtgtatgagatcatggtaaagtgctggaacagtgaaccagagaaaaga
ccttcattttaccatttgagtgaaatcgtggagagcttgttgcctggagagtacaaaaag
agctacgagaagattcacctggacttcctgaaaagtgatcacccagctgtcactcgaatg
agaggggactgtgacaatgcttacattggtgtcacctacaagaatgaagacaagttaaag
gatagagagagcggatttgatgagcagaggctgagcgctgacagtgggtacatcatcccc
ctgcctgacattgaccctgtttctgaagatgagcttggcaaaaggaacaggcacagttca
cagacatctgaagaaagtgccattgaaactggttccagtagctctacttttatcaagaga
gaggatgagaccattgaggacattgacatgatggatgacatcgggattgactcctcggat
ctggtagaggacagcttcctgtaa

DBGET integrated database retrieval system