KEGG   Meleagris gallopavo (turkey): 100542010Help
Entry
100542010         CDS       T01523                                 

Definition
alpha-type platelet-derived growth factor receptor-like
Orthology
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100542010
   04020 Calcium signaling pathway
    100542010
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100542010
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100542010
  Cell motility
   04810 Regulation of actin cytoskeleton
    100542010
  Cellular commiunity
   04510 Focal adhesion
    100542010
   04540 Gap junction
    100542010
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100542010
Protein kinases [BR:mgp01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   100542010
Enzyme-linked receptors [BR:mgp01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   100542010
Cytokine receptors [BR:mgp04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   100542010
Cellular antigens [BR:mgp04090]
 Proteins
  100542010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 1087 aa AA seqDB search
MGTPPRTFLILGCFLTGPILTLCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGMYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSLPEDQFILVEEGDPTVIPCRTSDPSAEVTLVNSLDKPVYAFYDSKQGFVG
NFLAGPYTCKTMVKGMEFKSDEFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPDASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSVLKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALILDL
MDDHQGSAGRQTVRCLAEGTPLPDVEWLVCKDIKKCSNDSSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSLSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgggtactcccccaaggacgttcctgatcctgggatgttttctcacaggaccgatccta
acactttgccagcttcctctgccgactattgttcccaacagaaatgagatggttgtacag
ctgaattccaatttcacactcaaatgctctggagacagcgaagtgagctggcagtacccg
gtgactgagggaagccacaggatagacatcaggcacgaggagaacaacagtggcctcttc
gtgacagtgctcgaagtcggaaatgcctcagccgctcacacgggcatgtacgtttgctat
tataaccacacgcaagtggaggatggggaagttgaggggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttccttaccagaagaccagttcatcctagtagaa
gaaggtgatcccaccgttatcccttgtcggacaagtgacccaagcgctgaagtgacttta
gttaacagtttagacaagcctgtctatgctttctatgacagcaaacagggcttcgtaggg
aatttccttgcaggaccatatacatgcaaaacaatggttaaaggcatggagttcaagtcc
gatgagttcctcatctatattttaagagctacttcacagctgccggttgaaattgaagct
ctgaagactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcccgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcgcagaagttggtttacacgttgaccattcctgacgca
tcagtgaaagacacaggggattatgaatgtactgctcgacatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaagggttcattcatctagagcctcag
tttagccctttggaagctgtcaatctacatgaagtcaaaaattttgtcgtcgatgtgcag
gcgtaccccgctccaaaaatgtactggttgaaggataatgtgactctgattgaaaatctt
actgagattgttactagttcaaacagggtccaggaaacacggtttcaaagtgtactaaaa
ttgatccgggccaaggaagaagacagtgggtactatactttggttgctgaaaatgaagat
gagattaagagatacaccttctcgttactaattcaagttccagccttgattttagacctc
atggatgaccaccaaggctctgctggcaggcagacagtgaggtgcttggctgaagggacc
ccgcttcctgatgtggaatggctggtttgcaaggacattaaaaaatgcagcaatgactct
tcctggactcttctgactaacaatatctctgatatacacatggaagcccacctggatgag
aagaatatggtagaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgaga
tgtgtagcaagaaacgaccttggtgctgttactcgggaactgaaacttgtggctcccacc
ttgcgatcagaactgacggtggctgctgccgtcttagtactgttggtgattgtgataatt
tcactgattgtcctggtcatcatctggaaacagaagccaaggtatgagataagatggaga
gtcattgagtctatcagccctgatgggcatgaatacatttatgtggacccaatgcagcta
ccgtatgactccagatgggagtttcctcgagatgggttagtgcttggtcgaatccttggt
tctggtgcattcggaaaagtggtggaagggacagcatatggactgagtcgttctcaacca
gtgatgaaagtagctgtgaaaatgctgaaacctacggctagatccagtgaaaaacaggca
ctcatgtctgaactgaagataatgacacatcttgggccccatctgaatattgtgaacctg
cttggagcttgtacaaaatcaggtcctatttacataatcactgaatactgcttttatggt
gatttggtgaactatctgcacaagaacagggacaacttcctcagccgacatccagagaaa
ccaaagaaagatctggatatttttgggatgaacccagctgatgaaagcacaagaagctat
gtgattttatcatttgaaaacactggagaatacatggacatgaaacaagctgatacaact
cagtacgtgccaatgctggaaaggaaagagggatctaaatactctgacattcagagatct
gtatatgatcgacctgcttcatataagaagaaatctttgtcagaatcagaagtaaaaaac
cttctttcagatgacagttcagagggtctgagcctactggatttgctaagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgtgtacaccgtgacttggca
gctcgtaatgtccttctggctcaaggcaaaatcgtgaagatctgtgactttgggttggct
agagacatcatgcatgattccaactacgtctccaagggcagcactttccttccagtaaaa
tggatggcacctgaaagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggtattctgctgtgggaaatattttctcttggtggcacaccatatcctggcatgatg
gttgactccactttctacaataagataaagagtggctaccgaatggcaaaacctgatcat
gcaaccaatgaagtgtatgagatcatggtaaagtgctggaacagtgaaccagagaaaaga
ccttcattttaccatttgagtgaaatcgtggagagcttgttgcctggagagtacaaaaag
agctacgagaagattcacctggacttcctgaaaagtgatcacccagctgtcactcgaatg
agaggggactgtgacaatgcttacattggtgtcacctacaagaatgaagacaagttaaag
gatagagagagcggatttgatgagcagaggctgagcgctgacagtgggtacatcatcccc
ctgcctgacattgaccctgtttctgaagatgagcttggcaaaaggaacaggcacagttca
cagacatctgaagaaagtgccattgaaactggttccagtagctctacttttatcaagaga
gaggatgagaccattgaggacattgacatgatggatgacatcgggattgactcctcggat
ctggtagaggacagcttcctgtaa

DBGET integrated database retrieval system