KEGG   Meleagris gallopavo (turkey): 100542024Help
Entry
100542024         CDS       T01523                                 

Gene name
SI, MGAM
Definition
(RefSeq) sucrase-isomaltase (alpha-glucosidase)
  KO
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100542024 (SI)
   00500 Starch and sucrose metabolism
    100542024 (SI)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100542024 (SI)
    3.2.1.20  alpha-glucosidase
     100542024 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 1811 aa AA seqDB search
MGKRKFSGLEITLIALFCLVVVVAIVLIALLATGVPAVKTTEFTPECPNILTVERIDCIP
DQTATKSVCDLRGCCWSPQSDTSVPWCFFSKNHGYKVDGSTRSTQTGFEATLTRLSSPSL
FGKDINTVLLTGEYQTANRFRFKITDPTTQRFEVPHEHVGSFSGPAASNLNYRVEVSSNP
FGIVVTRVSNGNVLFDTTIGPLQYADQFLQLSIKLPSSNIYGVGEHVHKQYRHDLNWKTW
PLFTRDVGPSEQMHNLYGVQTFFMCLEDSSGASFGVFLMNSNAMEFAVQPAPAVTYRTIG
GILDFYILLGNTPEQVVQEYLQFVGLPMLPSYWSLGFQLSRWNYGSLDEVKAVVDRNRLI
GLPYDAQITDIDYMEEKKDFTYDKVLFSDLPNFATYMHNNGQKYIIILDPAISTQDLLDN
SQYGSYVRGENRKVWVNESDGVTTLVGEVWPGEAVFPDFTNPECTSWWVEECRLFYNIVP
YDGIWIDMNEVSNFVQGSNKGCEQNDLNYPPFTPNIVDQLMFSKTLCMDAVQKWGKHYDV
HSLYGYSMAIATRQAIETVFPGKRSFLLSRSTFVGSGKHTGHWLGDNAATWEQLRWSIPG
MLEFSLFGFPYIGADICGFVFDTTEELCRRWMQVGAFYPFSRNHNAEGYIPQDPAVFGAD
SVLVQTSKHYLTIRYTLLPYLYTLFYRAHTRGDTVVRPVLHEFYSDEGTWGVDRQFLWGP
GLLISAVIDQGADVIDAYIPDAVWYEYETGARISERKQWTRMYLPADKLGLHLRGGYIYP
IQQPATTTVQSRQNPLGLIIALDEDNTASGELFWDDGESTGTIESNNYIYYEFTVSNRRL
QMNVVSGSYVDPNNLKFEEIKILGVLQEITEVSVSLNTGGQISSPNITYYPTEKVAHLTG
LQLELGRSYTIEWIQQQSINERFDCYPGIDPTREKCEQLGCVWDEAPSDPSSPSCYFVSD
NAYSVEEVEYSSSGLAANLILNSTSTRATDNYTAPIGTLRLEVKYHTNSMLQFKIYDYQN
ARYEVPVQLNLPASPTSTAEERLYDVSVQKKPFGIQVRRKSTGTVVWDSQLPTFTFSDMF
IQISTRLPSQYIYGFGENEHTPYRRDTNWRTFGMFTRDQSPADHLNSYGYQPFYMALEED
SNAHGVLLLNSNAMDVTLQPTPALTYRTIGGILDFYMVLGPTPELVVQEYTELIGRPVMP
PYWSLGFQLCRYGYSNDSEVAQLVEEMKATQIPYDVQYVDIDHMERQLDFTLSPRFSGLP
DLVNKIRGEGMRFIIILDPAISGNETDYPTFSRGVQNDVFMKRPNSNDIIYSRVWPFLPN
VQVNESLPEQTQIELYGAHAAFPDFLRNSTVEWWKREIAEFYNNPTDPSKSIKFDGLWID
MNEPATFMNAAFGGCRDEILNNPPYMPHLGSRSEGITFESPCMEGQQYLPDGTPVRHYDV
HCLYGWAQTRPTLEALQSVTRERGIVITRSTYPSSGRWAGHWLGDNAAAWDQLSKSIIGM
MEFSLFGISYTGADICGFFNDSEYELCLRWMQLGSFYPYSRNHNQKGTRRQDPASWNSTF
VDISRHVMNIRYTLLPYLYTLLHEAHVHGSTVVRPVLHEFAEEKVTWDIFEQFLWGPALL
ISPVMTPGAVTVNAYLPNARWYDYHTDEDINVRGEYRVLSAPLEHINLHIRGGYILAWQE
PANTTFFSRRNPMGLTAALNDSLLAEGQLYWDDGVRIDAYENGAYLLTSFSAQQNLLEIK
VEHHGYSDPNNLMFTEIKVLGLPTSVQQANVTQNGVIIPSSHMLIYDSTKKVMTITQLQL
YLGQSYTVQWS
NT seq 5436 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaggaagttcagtggcctggaaattactctcattgccctcttctgcctggtg
gtggtggtggccattgttctcattgcacttttagcaacaggagtacctgcagtcaaaact
acagaatttacaccagaatgtccgaacatattaacagtggagagaattgactgcatcccg
gatcaaacagcaacaaagagtgtctgtgacttgcgtggctgctgctggagtccccagagt
gataccagtgtaccctggtgctttttctctaaaaaccatgggtacaaagtggatgggtca
acaagatcaactcaaacaggatttgaggccacgttaacaaggctctcatcaccttctctc
tttggaaaagatatcaacactgtcctcctcacaggagagtatcagacagcaaatcgcttc
cggttcaagattactgatcctacaacacaaagatttgaagtcccccatgagcatgtgggc
tccttcagtggacctgcagcctccaatttaaactacagagtggaagtgagttcaaatcct
tttggtattgtggtgaccagagtgagcaacgggaatgtgctttttgatactaccatagga
ccactgcagtatgctgaccagtttttacagctatcaatcaaactacctagcagcaacatt
tacggcgtgggagaacatgtgcataagcagtaccgacatgatctcaactggaaaacctgg
cccctattcaccagggatgtcggtccctctgaacaaatgcacaacctatatggagttcag
actttcttcatgtgtttggaagacagcagtggagcctcttttggtgttttcctaatgaat
agcaatgccatggagtttgcggtgcagcctgctccagcagtgacctacagaaccattggc
ggcatccttgatttctatatcctcttggggaacactccagagcaagtagtgcaagagtat
ttgcagtttgtgggactcccaatgctgccttcctactggagtttgggcttccagctcagc
cgctggaattacggctccctggatgaggtgaaggctgtcgtggacaggaaccgtctgatt
ggactcccttatgatgctcagatcactgacattgattacatggaggaaaagaaagatttt
acatatgacaaagtgctgtttagtgatcttcctaattttgcaacttatatgcataacaat
ggacaaaaatatattatcatattggatcctgctattagcacacaagatctacttgataat
agtcaatatggcagctacgtgaggggggagaataggaaagtctgggtcaatgaatcagat
ggagtaacaacattagttggagaggtatggccgggggaagccgtgttcccagacttcacc
aacccagagtgcaccagctggtgggtggaagaatgcagactgttttataacatagtgcca
tacgatgggatctggattgatatgaacgaagtgtccaactttgttcaaggttcaaataaa
ggctgtgagcagaatgacttaaactatcctccattcactcccaatattgttgatcaactg
atgttctctaagacactttgtatggatgcagtgcagaaatggggcaagcactatgatgtc
cacagtctttatggatattccatggccatagcaacaagacaagccattgaaacggtgttt
ccaggaaaacgaagcttccttctttcaaggtctacttttgttggatcaggaaagcacaca
ggacactggctgggagataatgcagcaacatgggaacagctaagatggtcaattcctgga
atgctggaattcagcctctttggatttccttatattggagcagatatctgtgggttcgtt
tttgacacgacagaagaactttgcagacgatggatgcaagtaggagcattttatccattt
tcccggaatcacaatgctgaaggatacatacctcaggatccggctgtgtttggagctgat
tcagttttggtgcagacctccaagcactacctgaccattcgctacactttgctgccctac
ttatatacgctcttttatagagctcatactcgaggggacacagttgtacgtccagttttg
catgagttctactctgatgaagggacatggggagttgataggcagttcctgtggggtcct
gggctacttatttctgctgtaattgatcagggtgcagatgtaattgatgcatatattcct
gatgcagtatggtatgagtatgaaacgggggcaagaatctcagagagaaaacaatggacc
aggatgtacctgccagctgacaaactgggactccacttgagaggaggttacatttaccct
attcaacaaccagctactacaacagttcaaagccgccagaatccactgggacttataatt
gccctagatgaggacaatacagcttctggggagttattctgggatgatggagaatctaca
ggaacaattgagagtaacaactacatttactacgagtttacagtttccaatagacgtcta
caaatgaatgttgtaagtggcagttatgttgatccaaacaacttaaaatttgaagaaatc
aaaatcctgggagtactccaggaaataacggaggtttctgtctccctgaacactggaggg
caaatttcttcacctaatatcacctactatcctacagagaaggttgctcatttaacaggg
cttcagcttgaactgggaagatcctacacgatagaatggattcaacaacagagtatcaac
gaaaggtttgattgttatcccggcatagatccaacacgagaaaaatgtgaacaacttggc
tgtgtctgggatgaggcaccatcagacccgagtagtccatcctgctatttcgtctctgac
aacgcttattcagttgaagaagtagaatactcctcatcaggtttggcagccaacctgatc
ttaaacagtaccagtaccagagctactgacaattacactgcaccaattggtacgctacgc
ttggaggttaaatatcacaccaacagcatgctgcaatttaagatttatgattaccagaat
gcacgatacgaggttcctgtacaattaaatcttccagcctccccaacaagtacagctgag
gaacgactctatgatgtttcagttcagaaaaaaccatttggcatacaggttcgacgcaaa
agcacagggacagttgtctgggattcacagctgcctaccttcacgttcagcgacatgttc
attcagatttctacccgtttgccatcccagtacatatatggatttggagaaaatgagcat
accccgtatcgacgcgacacaaactggagaacctttggaatgttcacaagggatcaatct
cctgctgaccatttgaattcctatggttatcagcccttttacatggctctcgaagaagac
agcaacgcccatggagttctcttgcttaacagcaatgcgatggacgtgactcttcagcca
acccctgccctgacataccgcaccattggaggaattctcgacttctacatggttttgggc
ccaacaccagaacttgttgttcaggagtacactgaactaattggacgaccagtgatgcca
ccctactggtccttgggattccaattgtgccgctatggatacagtaatgattcagaagtc
gcccagttggtggaggagatgaaggcaactcaaattccctatgatgtccaatatgtagat
attgaccatatggaacggcaactggatttcactcttagcccacgctttagtgggttaccg
gatctagttaacaaaataagaggagaaggaatgagatttatcattatactggatccagcc
atctctggaaatgaaactgattatcctaccttctcaagaggtgtgcagaatgatgtcttc
atgaagcggccaaacagcaatgacatcatatattccagggtctggccgtttcttcccaat
gttcaagtcaatgagtcactccctgagcaaacccaaatagagctctatggagcacatgca
gctttcccagacttcctccgcaattccacagtagagtggtggaagagagaaattgcggag
ttctacaacaatcccactgatccctcaaaaagtatcaagttcgacggcctgtggattgac
atgaatgaaccggcaacttttatgaatgctgcatttggtggctgtagagacgagatccta
aataacccaccttatatgcctcatttgggatcccggtcagaaggcataacttttgaaagt
ccatgcatggaaggtcagcagtacctcccagatggtaccccggttagacactatgatgta
cactgcctttatggatgggctcaaacaagacctacccttgaagcattgcagagtgtcacg
agagaacgtgggattgtcatcacccgttcaacttatccgagcagtggaagatgggcagga
cattggctgggtgataacgctgcagcttgggatcaattgtcaaagtctattattggtatg
atggagttcagtctctttggaatatcatatacaggagctgatatctgtggcttctttaat
gactcagagtatgaattgtgtcttcgttggatgcagctgggttcattctacccatattca
aggaaccacaatcagaaaggaacgaggaggcaagatcctgcttcttggaactcaacgttt
gtggacatttcccggcatgtgatgaatatcagatacactctgttaccctacttgtacacc
ttattgcatgaggcccatgtccatggcagtactgtggtccgccctgtgctccatgagttt
gcagaagaaaaagtaacctgggatatatttgagcaattcctctggggacctgcactgctc
atcagccctgtaatgactccgggtgccgtaacagtgaatgcttacttacccaatgcccgc
tggtatgattaccacacagatgaagatattaatgttaggggagaatacagagttttatca
gctcctttggaacatatcaatcttcatattcgaggcggttacattctggcttggcaagaa
cctgctaatacaacctttttcagccggcgaaacccgatgggacttactgctgctttgaat
gacagtctgcttgcagaaggacagctgtactgggatgatggggtccgcattgatgcatat
gaaaatggtgcatacctgctcacatcatttagtgctcagcagaatcttttagagatcaag
gttgagcatcatggttacagtgatccgaacaacctgatgtttactgaaattaaagtcctg
ggtctgcccaccagcgttcagcaggcaaatgtaacacagaacggtgtgataataccatca
tctcacatgctgatatatgacagcaccaagaaggtcatgacgatcacccagcttcaactt
tatttaggacaaagctacacagtgcaatggagttaa

DBGET integrated database retrieval system