KEGG   Meleagris gallopavo (turkey): 100542024Help
Entry
100542024         CDS       T01523                                 

Gene name
MGAM
Definition
maltase-glucoamylase (alpha-glucosidase)
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100542024 (MGAM)
   00500 Starch and sucrose metabolism
    100542024 (MGAM)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100542024 (MGAM)
    3.2.1.20  alpha-glucosidase
     100542024 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 1823 aa AA seqDB search
MWWCSEPRCKSVAVCLLYSLFDCIEVLPTGGEDGNHQMGKRKFSGLEITLIALFCLVVVV
AIVLIALLATGVPAVKTTEFTPECPNILTVERIDCIPDQTATKSVCDLRGCCWSPQSDTS
VPWCFFSKNHGYKVDGSTRSTQTGFEATLTRLSSPSLFGKDINTVLLTGEYQTANRFRFK
ITDPTTQRFEVPHEHVGSFSGPAASNLNYRVEVSSNPFGIVVTRVSNGNVLFDTTIGPLQ
YADQFLQLSIKLPSSNIYGVGEHVHKQYRHDLNWKTWPLFTRDVGPSEQMHNLYGVQTFF
MCLEDSSGASFGVFLMNSNAMEFAVQPAPAVTYRTIGGILDFYILLGNTPEQVVQEYLQF
VGLPMLPSYWSLGFQLSRWNYGSLDEVKAVVDRNRLIGLPYDAQITDIDYMEEKKDFTYD
KVLFSDLPNFATYMHNNGQKYIIILDPAISTQDLLDNSQYGSYVRGENRKVWVNESDGVT
TLVGEVWPGEAVFPDFTNPECTSWWVEECRLFYNIVPYDGIWIDMNEVSNFVQGSNKGCE
QNDLNYPPFTPNIVDQLMFSKTLCMDAVQKWGKHYDVHSLYGYSMAIATRQAIETVFPGK
RSFLLSRSTFVGSGKHTGHWLGDNAATWEQLRWSIPGMLEFSLFGFPYIGADICGFVFDT
TEELCRRWMQVGAFYPFSRNHNAEGYIPQDPAVFGADSVLVQTSKHYLTIRYTLLPYLYT
LFYRAHTRGDTVVRPVLHEFYSDEGTWGVDRQFLWGPGLLISAVIDQGADVIDAYIPDAV
WYEYETGARISERKQWTRMYLPADKLGLHLRGGYIYPIQQPATTTVQSRQNPLGLIIALD
EDNTASGELFWDDGESTGTIESNNYIYYEFTVSNRRLQMNVVSGSYVDPNNLKFEEIKIL
GVLQEITEVSVSLNTGGQISSPNITYYPTEKVAHLTGLQLELGRSYTIEWIQQQSINERF
DCYPGIDPTREKCEQLGCVWDAPSDPSSPSCYFVSDNAYSVEEVEYSSSGLAANLILNST
STRATDNYTAPIGTLRLEVKYHTNSMLQFKIYDYQNARYEVPVQLNLPASPTSTAEERLY
DVSVQKKPFGIQVRRKSTGTVVWDSQLPTFTFSDMFIQISTRLPSQYIYGFGENEHTPYR
RDTNWRTFGMFTRDQSPADHLNSYGYQPFYMALEEDSNAHGVLLLNSNAMDVTLQPTPAL
TYRTIGGILDFYMVLGPTPELVVQEYTELIGRPVMPPYWSLGFQLCRYGYSNDSEVAQLV
EEMKATQIPYDVQYVDIDHMERQLDFTLSPRFSGLPDLVNKIRGEGMRFIIILDPAISGN
ETDYPTFSRGVQNDVFMKRPNSNDIIYSRVWPFLPNVQVNESLPEQTQIELYGAHAAFPD
FLRNSTVEWWKREIAEFYNNPTDPSKSIKFDGLWIDMNEPATFMNAAFGGCRDEILNNPP
YMPHLGSRSEGITFESPCMEGQQYLPDGTPVRHYDVHCLYGWAQTRPTLEALQSVTRERG
IVITRSTYPSSGRWAGHWLGDNAAAWDQLSKSIIGMMEFSLFGISYTGADICGFFNDSEY
ELCLRWMQLGSFYPYSRNHNQKGTRRQDPASWNSTFVDISRHVMNIRYTLLPYLYTLLHE
AHVHGSTVVRPVLHEFAEEKVTWDIFEQFLWGPALLISPVMTPGAVTVNAYLPNARWYDY
HTDEDINVRGEYRVLSAPLEHINLHIRGGYILAWQEPANTTFFRYDKNLLEIKVEHHGYS
DPNNLMFTEIKVLGLPTSVQQANVTQNGVIIPSSHMLIYDSTKKAHKTPQQAHVADVLTN
DVPRRIGSGHRNEDDGRVRLVFS
NT seq 5472 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggtgctcagagccgcgctgtaaatctgttgctgtgtgtttgctttactcactc
tttgactgtattgaagttcttcctacaggtggagaggacgggaaccaccagatgggcaag
aggaagttcagtggcctggaaattactctcattgccctcttctgcctggtggtggtggtg
gccattgttctcattgcacttttagcaacaggagtacctgcagtcaaaactacagaattt
acaccagaatgtccgaacatattaacagtggagagaattgactgcatcccggatcaaaca
gcaacaaagagtgtctgtgacttgcgtggctgctgctggagtccccagagtgataccagt
gtaccctggtgctttttctctaaaaaccatgggtacaaagtggatgggtcaacaagatca
actcaaacaggatttgaggccacgttaacaaggctctcatcaccttctctctttggaaaa
gatatcaacactgtcctcctcacaggagagtatcagacagcaaatcgcttccggttcaag
attactgatcctacaacacaaagatttgaagtcccccatgagcatgtgggctccttcagt
ggacctgcagcctccaatttaaactacagagtggaagtgagttcaaatccttttggtatt
gtggtgaccagagtgagcaacgggaatgtgctttttgatactaccataggaccactgcag
tatgctgaccagtttttacagctatcaatcaaactacctagcagcaacatttacggcgtg
ggagaacatgtgcataagcagtaccgacatgatctcaactggaaaacctggcccctattc
accagggatgtcggtccctctgaacaaatgcacaacctatatggagttcagactttcttc
atgtgtttggaagacagcagtggagcctcttttggtgttttcctaatgaatagcaatgcc
atggagtttgcggtgcagcctgctccagcagtgacctacagaaccattggcggcatcctt
gatttctatatcctcttggggaacactccagagcaagtagtgcaagagtatttgcagttt
gtgggactcccaatgctgccttcctactggagtttgggcttccagctcagccgctggaat
tacggctccctggatgaggtgaaggctgtcgtggacaggaaccgtctgattggactccct
tatgatgctcagatcactgacattgattacatggaggaaaagaaagattttacatatgac
aaagtgctgtttagtgatcttcctaattttgcaacttatatgcataacaatggacaaaaa
tatattatcatattggatcctgctattagcacacaagatctacttgataatagtcaatat
ggcagctacgtgaggggggagaataggaaagtctgggtcaatgaatcagatggagtaaca
acattagttggagaggtatggccgggggaagccgtgttcccagacttcaccaacccagag
tgcaccagctggtgggtggaagaatgcagactgttttataacatagtgccatacgatggg
atctggattgatatgaacgaagtgtccaactttgttcaaggttcaaataaaggctgtgag
cagaatgacttaaactatcctccattcactcccaatattgttgatcaactgatgttctct
aagacactttgtatggatgcagtgcagaaatggggcaagcactatgatgtccacagtctt
tatggatattccatggccatagcaacaagacaagccattgaaacggtgtttccaggaaaa
cgaagcttccttctttcaaggtctacttttgttggatcaggaaagcacacaggacactgg
ctgggagataatgcagcaacatgggaacagctaagatggtcaattcctggaatgctggaa
ttcagcctctttggatttccttatattggagcagatatctgtgggttcgtttttgacacg
acagaagaactttgcagacgatggatgcaagtaggagcattttatccattttcccggaat
cacaatgctgaaggatacatacctcaggatccggctgtgtttggagctgattcagttttg
gtgcagacctccaagcactacctgaccattcgctacactttgctgccctacttatatacg
ctcttttatagagctcatactcgaggggacacagttgtacgtccagttttgcatgagttc
tactctgatgaagggacatggggagttgataggcagttcctgtggggtcctgggctactt
atttctgctgtaattgatcagggtgcagatgtaattgatgcatatattcctgatgcagta
tggtatgagtatgaaacgggggcaagaatctcagagagaaaacaatggaccaggatgtac
ctgccagctgacaaactgggactccacttgagaggaggttacatttaccctattcaacaa
ccagctactacaacagttcaaagccgccagaatccactgggacttataattgccctagat
gaggacaatacagcttctggggagttattctgggatgatggagaatctacaggaacaatt
gagagtaacaactacatttactacgagtttacagtttccaatagacgtctacaaatgaat
gttgtaagtggcagttatgttgatccaaacaacttaaaatttgaagaaatcaaaatcctg
ggagtactccaggaaataacggaggtttctgtctccctgaacactggagggcaaatttct
tcacctaatatcacctactatcctacagagaaggttgctcatttaacagggcttcagctt
gaactgggaagatcctacacgatagaatggattcaacaacagagtatcaacgaaaggttt
gattgttatcccggcatagatccaacacgagaaaaatgtgaacaacttggctgtgtctgg
gatgcaccatcagacccgagtagtccatcctgctatttcgtctctgacaacgcttattca
gttgaagaagtagaatactcctcatcaggtttggcagccaacctgatcttaaacagtacc
agtaccagagctactgacaattacactgcaccaattggtacgctacgcttggaggttaaa
tatcacaccaacagcatgctgcaatttaagatttatgattaccagaatgcacgatacgag
gttcctgtacaattaaatcttccagcctccccaacaagtacagctgaggaacgactctat
gatgtttcagttcagaaaaaaccatttggcatacaggttcgacgcaaaagcacagggaca
gttgtctgggattcacagctgcctaccttcacgttcagcgacatgttcattcagatttct
acccgtttgccatcccagtacatatatggatttggagaaaatgagcataccccgtatcga
cgcgacacaaactggagaacctttggaatgttcacaagggatcaatctcctgctgaccat
ttgaattcctatggttatcagcccttttacatggctctcgaagaagacagcaacgcccat
ggagttctcttgcttaacagcaatgcgatggacgtgactcttcagccaacccctgccctg
acataccgcaccattggaggaattctcgacttctacatggttttgggcccaacaccagaa
cttgttgttcaggagtacactgaactaattggacgaccagtgatgccaccctactggtcc
ttgggattccaattgtgccgctatggatacagtaatgattcagaagtcgcccagttggtg
gaggagatgaaggcaactcaaattccctatgatgtccaatatgtagatattgaccatatg
gaacggcaactggatttcactcttagcccacgctttagtgggttaccggatctagttaac
aaaataagaggagaaggaatgagatttatcattatactggatccagccatctctggaaat
gaaactgattatcctaccttctcaagaggtgtgcagaatgatgtcttcatgaagcggcca
aacagcaatgacatcatatattccagggtctggccgtttcttcccaatgttcaagtcaat
gagtcactccctgagcaaacccaaatagagctctatggagcacatgcagctttcccagac
ttcctccgcaattccacagtagagtggtggaagagagaaattgcggagttctacaacaat
cccactgatccctcaaaaagtatcaagttcgacggcctgtggattgacatgaatgaaccg
gcaacttttatgaatgctgcatttggtggctgtagagacgagatcctaaataacccacct
tatatgcctcatttgggatcccggtcagaaggcataacttttgaaagtccatgcatggaa
ggtcagcagtacctcccagatggtaccccggttagacactatgatgtacactgcctttat
ggatgggctcaaacaagacctacccttgaagcattgcagagtgtcacgagagaacgtggg
attgtcatcacccgttcaacttatccgagcagtggaagatgggcaggacattggctgggt
gataacgctgcagcttgggatcaattgtcaaagtctattattggtatgatggagttcagt
ctctttggaatatcatatacaggagctgatatctgtggcttctttaatgactcagagtat
gaattgtgtcttcgttggatgcagctgggttcattctacccatattcaaggaaccacaat
cagaaaggaacgaggaggcaagatcctgcttcttggaactcaacgtttgtggacatttcc
cggcatgtgatgaatatcagatacactctgttaccctacttgtacaccttattgcatgag
gcccatgtccatggcagtactgtggtccgccctgtgctccatgagtttgcagaagaaaaa
gtaacctgggatatatttgagcaattcctctggggacctgcactgctcatcagccctgta
atgactccgggtgccgtaacagtgaatgcttacttacccaatgcccgctggtatgattac
cacacagatgaagatattaatgttaggggagaatacagagttttatcagctcctttggaa
catatcaatcttcatattcgaggcggttacattctggcttggcaagaacctgctaataca
acctttttcaggtatgataagaatcttttagagatcaaggttgagcatcatggttacagt
gatccgaacaacctgatgtttactgaaattaaagtcctgggtctgcccaccagcgttcag
caggcaaatgtaacacagaacggtgtgataataccatcatctcacatgctgatatatgac
agcaccaagaaggctcataaaaccccccagcaagctcacgttgctgacgtgttgacaaat
gatgtacccagaaggatcggatctggtcacagaaatgaagatgatgggagagtgcgcttg
gtcttcagctaa

DBGET integrated database retrieval system