KEGG   Meleagris gallopavo (turkey): 100542096Help
Entry
100542096         CDS       T01523                                 

Gene name
KAT6A
Definition
(RefSeq) K(lysine) acetyltransferase 6A
  KO
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100542096 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
24
AA seq 2008 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDGKPNVDWNKLIKRAIEGLGESSGSSLKN
IERFLKGQKDVSALFGGSAASVFHQQLRLAVKRAVGHGRLLKDGPLYQLNTKATTNADGK
ESFESLSCLPPVCLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHP
SCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTR
MPKGMWICQICRPRKKGRKLLHKKAAQIKRRYANPIGRPKNRLKNQNATSKGTFSKVRTG
PGRGRKRKITLSSQSASSEGGYLEQTDMLDYCREGSAALKFNKKTKGLIDGLTKFFTPSP
DGRKARGEVVDYSQQYRIRKKGTRKSSTSEWPTDNQDGWDGKQENEERFFGSQDVLTEKD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIQTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQHDKQLSIKKLSKLTG
ICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQEHMAKLRNNVRPIDVDAECLRWTPVIV
SNSVVSEDEEEETEDGENEEQQHDKDSESSMVKSVSWEKKEQEPYSPTKNEKKPDVIAPV
NSTRPNKHVFSLDSLPANSQTSRRGRWNRKGKKLREPFCEKEPTLPTEDKIAIPSERCSE
CEEKSVASRGRCSECEEKSSALQERCECEEKSPTPRGHYAEDEEKSVVSQVQYGKNEKSA
VPHQHYSEGVERWRGQLKKNTEPLKNRFPEDCERLPHCYSDSDRTLLRCFSESSEEEDDD
PVSPRSSSPPVLTKPTLKRKKPILHRKRRVRKRKHHNSSVVTETISETTEVLDEPFEDSD
AERPMPRLEPTFEIEEEEEEEEDEEDEENELLSSGYFQHLAPQDTLRNRPSSKRKSKDEE
ESDDNNDTPTLKPLSMLRKCEANDSSLDPDTSTPMKKKKGWPKGKSRKPVHWKKRPGRKP
GFKLNRDKVPPSVQGEGIDAVIANSKTGRKSKISDKEENVEQKEELPLNEERKEEDVNME
AEEVGEGEEEDAASSEVRAVSPVDSSSSPVPEVKEPEIEEEVEEKPQVLEEQRQSEEEQQ
ELDEPEQDHEEDDEIAVVANQNEDHDADDEDDGHLESVKKKELEEQPVREGVKEEPDVQE
CFLETNIPSSREDAKGKDEAEADSEEEQASNETSAGSEHVPGSEDDREEDSSNKEGLIEL
KEEEEIPHSELDLETVQAVQSLTQEEGNEHDVAYQDCEETLAACQTLQSYTQTEEDPQIS
MVEDCQASEHNSPISSVQSHPSQSVRSVSSPNVPALESSYTQISPEQGSLSAPSMQNMET
SPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNNSSQSSCSY
GGLSSSSSLTQNSCVVTQQMANIGSSCSMMQQSTVQPAANCNIKSPQSCVIERPPSNQQP
AAQPQQQQPQSQQPQPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGTTGNISIYERIP
GDFGAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAP
SHPLAGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHIS
IRSKSAPLPSATAHQQQLYGRSPPAVAMQAGPRTLAVQRGMNMGVNLMPTTPYNVNSMNM
NTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNM
MYTGPSHHSYMNAAGVPKQSLNGPYMRR
NT seq 6027 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgccaaccccctgtatacggagtggattttggaggcaatcaaaaaggta
aagaagcaaaaacagcgtccttcagaagagaggatatgcaatgcagtgtcttcgtcacat
ggcttggatcgcaaaactgttctggaacagttagagttgagcgttaaagatggaactatt
ttaaaagtctccaacaagggtctcaactcctataaggatcctgataatcctgggagaata
gcacttccgaagcctcggaaccatggaaagttggatggtaagccaaacgtggactggaat
aaactcatcaaacgggcaattgagggcttgggtgagtctagtggctcatccttgaagaac
atcgaacgttttctgaaaggtcagaaagatgtgtctgcattatttggaggtagtgctgcc
tccgtttttcaccagcaactacgattagctgtcaaacgtgcagttggccatggcaggctc
cttaaagacggacctctgtaccagctcaacactaaagcaaccactaatgctgatgggaag
gagagttttgagtctctttcctgtctgcctccggtgtgtctccttccccatgaaaaggat
aagccggttgctgaaccaattccaatctgcagtttctgccttggtacaaaagagcaaaat
cgggagaagaaacctgaagagctcatctcttgtgctgactgtggcaacagtggtcatcct
tcctgtttgaagttctcaccagagctgacagttcgagtcaaagccttgcgatggcaatgt
attgaatgcaaaacctgcagttcctgtcgagatcagggcaaaaatgctgataacatgcta
ttttgtgactcgtgtgaccgtggctttcacatggagtgctgtgatccccctcttaccagg
atgccaaaaggtatgtggatatgtcagatatgtcggccacgtaagaaaggaagaaaactt
ttacacaagaaggcagcacagataaaacggcgctatgctaatccaataggacgtcccaaa
aacaggttaaagaatcaaaatgcaacatcaaaaggaaccttcagcaaagttcgaactggc
cctggtcggggtcggaagcgtaagataactctgtccagccagtcagcatcatcagaagga
ggatacctggaacagacagatatgttggactactgcagagaaggcagtgctgccttgaag
tttaacaagaaaaccaaagggcttatagatggccttactaaattcttcactccctcccct
gatggacgaaaagctcgaggggaagtggtagactattctcagcagtataggatcaggaaa
aagggtaccagaaaatctagcacttcagagtggcccacagacaatcaggatggctgggat
ggaaagcaggaaaatgaagagcgcttttttggaagccaggatgtcttaactgaaaaagat
atggagttgtttagagatattcaggagcaagcactgcagaaagtaggggtgactggacct
cctgatccacaagttcgatgcccctctgtcatcgaatttggcaagtatgaaattcagacc
tggtactcttccccttatccacaagaatattcgaggctacccaagctgtacctttgtgaa
ttctgtctaaagtatatgaaaagcagaactattctccaacagcatatgaaaaaatgtggc
tggtttcatcctccagccaatgaaatttatagaaaaaacaatatttcagtctttgaggtt
gatggcaatgtcagcactatctactgccagaatttgtgcttgttagccaaactcttcctg
gaccataagactctttattatgatgtggaaccatttcttttctacgtgctgacacagaat
gatgtcaagggttgtcaccttgttggttacttttccaaggaaaaacactgccaacagaaa
tacaatgtttcctgtatcatgattcttccgcagtaccagcgtaagggctatggcaggttc
ctcattgatttcagctatctgctttcaaagcgtgagggccaagcaggatcaccagagaag
cccctgtcagacctggggcggctctcatatatggcttattggaaaagcgtaatattggag
tgcctttatcatcaacatgacaagcagttaagcatcaagaaattaagtaagctgactgga
atctgccctcaagatatcacttccactctgcatcacctccgaatgcttgatttccgtagt
gatcaatttgtcatcattcgtcgagagaagcttatccaagaacatatggcaaagcttaga
aataatgtgcgaccaatagatgtggatgcagagtgtctgcgttggacacctgtcatagtt
tccaactctgttgtctctgaggatgaggaagaggagacagaggatggggaaaatgaagag
caacagcatgataaagattcagagtccagtatggtaaaatctgtgtcatgggagaagaaa
gaacaagaaccctattcaccaacaaagaatgaaaaaaagccagatgtcattgctcccgtc
aattctacgcggccaaacaagcacgttttttcactggacagtcttccagcaaacagtcaa
acatcacgaagaggtcgatggaaccgcaagggcaaaaaacttcgagaacccttttgtgag
aaggaaccaacgttgcccactgaggacaaaatagccattcccagtgaacggtgcagcgaa
tgcgaggagaaatcagtagcttcacgaggccggtgcagtgaatgtgaggaaaagtcatca
gccttgcaggaaaggtgtgaatgtgaagagaagtctccaaccccaagaggccattatgct
gaagatgaggaaaaatctgtggtttcccaagtgcagtatggcaaaaatgaaaaatctgca
gttccccatcagcattatagtgaaggtgtggaaaggtggagaggacagctgaaaaagaac
acggagccactgaagaataggttcccagaagactgtgaaagattaccccactgctacagt
gatagtgataggacacttctgaggtgttttagtgagagcagtgaagaggaagatgatgac
cctgtgagtccccgatcaagctctccacctgttcttaccaaaccaacattaaaacgaaag
aaaccaattcttcatcggaagaggagagtacgtaagcgtaagcaccacaacagcagtgtt
gttactgaaacaatctcggagaccacagaagtgctggatgagccatttgaggactcagat
gctgaacgaccgatgccccgattagagcctacatttgaaattgaggaggaggaggaggaa
gaagaggacgaggaagacgaggagaatgaacttttgtccagtggatactttcagcactta
gccccacaagacaccctcaggaacagaccctcttctaagaggaagtccaaagatgaggag
gagtctgatgacaataatgatactccaactttgaaaccattatctatgctgagaaagtgt
gaagcaaatgattcttcacttgatccagatacttctacacccatgaaaaagaagaaggga
tggccaaaaggcaaaagccgaaaaccagtccattggaagaaaagacccggtcgaaaacca
ggatttaagctgaaccgggataaagtgccaccatcagttcagggagagggaattgatgca
gtgatagctaattcaaaaacaggacgtaagtccaaaatttcagataaagaggaaaacgtt
gagcaaaaagaagagctacctcttaatgaggaaaggaaagaggaagatgtgaatatggaa
gcagaagaggttggagagggagaagaggaagatgcagccagcagtgaagtaagagcagtt
tctccagtggacagcagcagtagtccagtaccagaagttaaagaacctgaaatagaagag
gaggtggaggagaaaccacaggtattagaagagcaaaggcaatcagaagaagagcagcaa
gagctagatgaacctgagcaggaccatgaggaagatgatgaaattgcagtagtggcaaat
caaaacgaagaccatgatgctgatgatgaggatgatggtcatctagagtctgtgaagaaa
aaagaattggaggagcagcctgtaagagaaggggtgaaggaggaacctgatgttcaggaa
tgttttttagaaacaaatataccaagcagtagagaagatgcaaaaggaaaagatgaagca
gaggcagattctgaggaagagcaggcttccaatgaaacatcagcaggctcagagcacgtc
cctgggtctgaagatgatcgtgaagaagattcaagtaataaagaaggtttaattgaatta
aaagaagaggaagagattcctcatagtgaactagatcttgaaactgttcaagcagtccag
tccttgacacaggaggaaggcaatgaacatgatgtagcttaccaggactgtgaagagact
cttgcggcttgtcaaacgctgcagagttacacccagactgaggaggatcctcagatatca
atggttgaagactgccaggcctcagaacacaacagtccaatatcctctgttcagtcccac
cccagccagtctgttcgttctgtcagcagcccaaatgtgcctgctctggagagcagttac
acccagataagccctgaacaaggatccctgtccgcaccctctatgcagaacatggagacc
agccccatgatggatgtgccttcagtatcagaccactctcagcaggtggtggatagtggc
ttcagtgaccttggcagcattgagagcactacagagaattatgaaaacccgagcagctat
gactccactatgggaggcagcatttgtggaaataactcttctcagagcagctgttcctat
gggggactgtcttcttccagcagcctcacgcagaacagttgtgttgtcactcagcaaatg
gcaaacattggcagcagttgcagcatgatgcagcaaagcactgtccagcctgcagcaaac
tgtaatatcaagtcacctcagagctgtgtcatagaaagacctccaagtaaccagcagcca
gcagcacagccacaacagcagcagcctcagtcacagcagccacagcctccacctccaccc
cagcagcaacctccgctgtcccagtgcagtatgaacaacagcttcaccccagcacctatg
atcatggaaatacctgagtcgggaaccactggtaacataagtatctatgagaggattcca
ggggattttggggctgggagctattcacaaccatcggccacattcagtttagccaagttg
cagcagctgacaaacaccattatggaccctcatgccatgccttatagccattctcctgct
gtgacttcctatgcaaccagtgtttctctgtccaacacaggattggctcagctagctccc
tctcatccgttagcaggcacaccacaagcacaagccaccatgacacccccaccaaacctg
gcatccactaccatgaacctcacgtcacctctgcttcagtgtaatatgtctgctaccaat
attggcattccacacacacagaggttgcaggggcaaatgccggtcaaggggcatatctcc
attcgctctaaatcagcacccctgccctctgcaactgcacaccagcagcaactctatggc
cgcagcccacctgctgttgccatgcaggctggccctcgtacgttggctgttcagcgaggt
atgaacatgggggtcaacctaatgccaaccaccccatacaatgttaattccatgaatatg
aacacccttaatgccatgaacagctacagaatgacacaacccatgatgaacagcagttac
catagtaaccctgcctacatgaaccagacagcacagtatcctatgcagatgcagatggga
atgatggggagccaggcctatacccagcagcctatgcagccaaatcctcatggaaatatg
atgtacactggcccctcccatcacagctacatgaatgctgctggggtgcccaagcagtct
ctcaatggaccgtacatgagaagatga

DBGET integrated database retrieval system