KEGG   Meleagris gallopavo (turkey): 100542097Help
Entry
100542097         CDS       T01523                                 

Definition
replication protein A 32 kDa subunit-like
Orthology
K10739  
replication factor A2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100542097
   03420 Nucleotide excision repair
    100542097
   03430 Mismatch repair
    100542097
   03440 Homologous recombination
    100542097
   03460 Fanconi anemia pathway
    100542097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
25
AA seq 267 aa AA seqDB search
MWGGHGNFDGGYGPAGGYTQSPGGFSSPTGAQAEKKQRSRSQSIVPCTVSQLLAAEQVDE
AFRIHDVEISQVTVVGIVRHAEKAPTNILYKVDDMTAAPMDVRQWVDTDEAGSENIVVPP
GTYVKVAGHLRSFQNKKSLVAFKIMPLENMNEFTTHILETVNAHMILRKNLMLASRAPQS
FTSAGMSDVGSYGGGSLPVNGLTAHQSQVLNLIKNCHSPEGMSLQELKLQLHNVSIPTIK
QAVEFLSSEGHIYSTVDDDHYKSTDAD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggggcgggcacggtaacttcgacggtggctacggcccggcgggcggctacacgcag
tccccgggaggtttcagctctcctacaggcgcgcaggcggagaagaagcagcgcagccgc
tcgcagagcatcgtgccctgcaccgtgtcgcagctgctggcggccgagcaggtggacgag
gcgttccgcatccacgatgtggagatctcacaggtcaccgtggttggcatcgtaaggcac
gcagagaaggcgcccaccaacatcctgtacaaggtggacgacatgacagcagcacccatg
gatgtgcggcagtgggttgacaccgacgaggcaggtagtgagaatatcgtggtaccccca
ggaacttatgtaaaagtcgctggtcatcttcggtcttttcagaataagaaaagtttggtg
gcatttaagatcatgcctttggaaaacatgaatgagttcaccacgcacatacttgagaca
gtcaatgcacatatgatcctcagaaaaaatctgatgttagcatcaagagcacctcagtca
tttacctctgctggaatgagtgacgttgggagctacggtggaggcagcctgcctgtgaat
ggactcacagcacatcagagtcaggtgctgaacctgattaaaaactgccattctccagaa
ggtatgagtcttcaagagctgaaacttcagctccacaatgtcagcataccaacaatcaag
caagcagttgaattccttagcagtgagggacacatctactctactgtggatgatgatcac
tataagtctacggatgctgattga

DBGET integrated database retrieval system