KEGG   Meleagris gallopavo (turkey): 100542160Help
Entry
100542160         CDS       T01523                                 

Gene name
USP35
Definition
ubiquitin specific peptidase 35
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 998 aa AA seqDB search
MDKILEAVVMSSYPNNVKQGLVRRVIEASKQPMDSEQCWSMLELCTKLYLVGDTKYKREI
GKEVLEVYGHYHPEEFEEFFNVRFLLSLLQEGYGPLGKRSHYVLDYIQLGLQFVLESPSA
NSIFSLLRIEVLRKVCERPSPKQCAKISKLLMQHPQCIPTGKHQVLFCQQLIRCIGQFQC
VSEGEDDIMEFLEQVNKVSGLLQRIWRTQTSAILPSLKELFTIISSTEEQEVPSNALASV
VQFVPLELMDGVIRNLTNDDSITDVQMMMAIGRMIDWVSWPLGKNIDKWIIALLKGLAAV
KKFSILIEVTLSKIEKVFSKLLYPIVREGALSVLQYMLLSFQHSHEAFHLLLPHIPRLVA
SLKKEDSNSATSSLEQLAELIHCMFFRFSGYPDLYEPVLEAIKALPIPNEDRIKHLLGQN
AWTSQKNELACFYPRLASKSETGKIGLINLGNTCYMNSVIQSLFMASDFRHSVLNLTEGI
SQPLMTKLQWLFAFLEHSQRPAISPESFLSASWPPWFTPGAQQDCSEYLKYLLDRLHEEE
KIGKRIYQKLKESSLMSQATEHHSLNKTLIEKMFGGKMMTKIRCLKCLNISSREEAFTDL
SLAFPPPDRPVRRPGSTSVLPVAEISPQFIEPHKNPSQPTGSPWVRRKPPVPGDPAAQPV
PVETLGFREPRESAHPLSNSAVSVDTTKDPHLAFAEQTCAPKDSRSVPDLINYFLSPERL
TAENQYHCEQCASLQDAEKVAQLTEGPHYLILTLLRFSFDSHTMKRRKILDNVSIPVVLK
LPILVSSEETEDVCRHGEDRADLGSTFVSAVYDLCSVVVHSGISSESGHYYCYSRECTDT
VPRAPPRDGAPKPASDKQLDFEIPWYLFNDTRVSFSSFESVSNVTSFFPKDTAYVLFYRQ
REGRPCSPLHEAVAEASHLHSELSLNKDLMEAISKDNILYLQEQEKEARNRAAYISTLPK
SPLWWRDFERDKDDDSSSGGCSPGGGGSGSGSFHGLVF
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atggataagatactggaagctgtggtgatgtcctcataccccaacaatgtgaagcaaggg
cttgtgaggcgcgtcattgaggcatcaaagcagcccatggacagtgagcaatgctggtcc
atgctggagctgtgcaccaagctttatctcgtgggggacacaaaatataaaagagagatt
gggaaagaggttttggaggtctatggccactaccacccagaggaatttgaggagttcttc
aatgtccgcttcctactgagtctccttcaggaaggctatgggcctctgggaaagagaagc
cattatgtacttgattatatccagttaggactgcagtttgtcttggaaagtccatcagca
aacagcattttcagcttactgaggatcgaggtgctccggaaagtctgtgagaggcccagc
cccaagcagtgtgcaaagatcagcaaactcttaatgcaacatcctcagtgcatccccaca
ggcaaacaccaggtcctgttttgtcagcagctgatacggtgcattgggcagtttcagtgt
gtctctgagggggaagatgacatcatggagtttttggagcaggtgaacaaggtgagcggt
ctgctgcagaggatctggaggactcagacctcggccatcctgccctcgctgaaggagctg
ttcactatcatttcttcaacagaggagcaggaggtgccatccaatgccttagccagcgtg
gtccaatttgtccctctggagctcatggatggtgtcataagaaacctaaccaatgatgac
agcatcaccgatgtgcaaatgatgatggccattggcaggatgatcgactgggtgtcatgg
cccctggggaagaacatagacaagtggatcattgctctgctgaagggtttggctgcagtg
aaaaagttcagcatcttgattgaagttactctttcaaaaattgaaaaggtcttctccaag
ctgctgtaccccattgtaagagagggggctttgtctgtcctacagtacatgctcttgagt
ttccagcactcccatgaagcatttcacttgctgctccctcacatccccaggctggtggcc
tcgctgaagaaggaggattccaactctgccaccagctccctggagcagctggctgagctc
atccactgcatgttcttccgcttctcaggatatccagatctctatgaaccagtgttggaa
gctataaaagctcttccaattccaaacgaagaccggattaaacatctcttgggacaaaat
gcttggacctcccagaagaatgagctggcctgcttctacccacgcctggcctccaaatca
gagacagggaagattggattaattaacttgggaaacacttgctacatgaacagtgtcatc
cagtctcttttcatggcttcagactttcggcattccgtattgaatttaactgagggcatc
tcccagcccctgatgacaaaactccagtggctctttgcatttttggagcacagtcagcga
cctgccatctcacctgagagcttcctctctgcctcctggccaccctggtttactcctggt
gctcagcaggactgctcggagtatctcaagtacctcctggatcgattacatgaagaagaa
aaaattggaaagaggatctaccagaagctcaaggagtccagcttgatgtctcaagccacg
gagcaccattccttaaacaagacattgatcgagaagatgtttggggggaaaatgatgacc
aagattcgttgcttgaaatgtttgaacatctcctctagagaagaagccttcacagacctg
tcgttggccttcccccctccggataggcccgtacgcagaccaggaagtacctctgtttta
cctgtggcagaaatcagcccacagtttattgagccccacaaaaacccaagccagccaaca
ggctctccctgggtccggaggaagccccctgtgcctggagatcccgcagcccagccagtg
ccggtggaaacactgggttttcgggaacccagagaatcagcacatcccctaagcaacagt
gctgtcagcgtggatacaaccaaagatcctcacttggcttttgcggagcagacatgcgct
cctaaggattcccgatctgtcccagatttaatcaactattttctgtccccagagaggctg
acagcagagaatcaataccactgcgagcaatgtgcttccttgcaggatgctgagaaggtg
gcacagctgacagagggcccgcactacctcatcctcacactgctgcggttctccttcgac
tcgcacaccatgaagaggaggaagattctggacaatgtctccatccctgtggtgcttaaa
ctgcccatccttgtcagctcagaggaaactgaggacgtttgccggcacggcgaggacagg
gctgacctgggcagcacctttgtgtccgccgtgtacgatctctgcagcgtggtggtgcat
tcgggcatctcctccgagagcggccactactactgctactccagagagtgcactgatacc
gtgccccgcgcaccgccccgggatggggcaccaaaaccggcttctgacaagcagttggac
tttgaaatcccgtggtacctcttcaacgacaccagggtttccttctcctcctttgaatca
gtcagcaatgtgacttctttcttccccaaggacactgcctacgtgctcttctacaggcag
cgggagggcaggccatgctccccactgcatgaggctgtggcagaagccagccacctgcac
agtgaactctccctcaataaggacttgatggaagccatctccaaagacaacatcctctac
ttgcaggagcaggaaaaagaggcgaggaacagagctgcctacatttccaccttgccaaaa
tcccctctatggtggagagactttgagagggacaaggacgatgacagctcgtcaggagga
tgcagtcctggtgggggtggaagtggatctggctcttttcatggacttgtcttctag

DBGET integrated database retrieval system