KEGG   Meleagris gallopavo (turkey): 100542201Help
Entry
100542201         CDS       T01523                                 

Gene name
USP15
Definition
ubiquitin specific peptidase 15
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100542201 (USP15)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100542201 (USP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 981 aa AA seqDB search
MAEGGAADLETQRTDVAALLKTALRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDGDSQSLKEHLIDELDYILLPTEGWNRLVSWYTLMEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPGEKETRLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGSSTPKSPGASNFSTLPK
ISPSLSNNYNNMNNRNVKNSNYCLSSYTAYKNYDYSEPGRHNEQPGLCGLSNLGNTCFMN
SAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKYSYVTPRA
FKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEE
AWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVFLV
RMDPLAKPMQYKVVVPKIGNILDLCTALSALSGVAADKMIVTDIYNHRFHRIFAMDENLS
SIMERDDIYVFEIAINRTEDTEQVIIPVCLREKCRHTSYSHSGSSLFGQPFLIAVPRNNT
EDKLYNLLLLRMCRYVKTCTETDDTEGSLRCCKEHGINGNGPNGIHEEGSPSEMETDEQD
DESSQDQELPSENENSQSEDSVGGDNDSENGLCTEDTCKGQPLTGHKKRLFTFQFNNLGN
TDINYIKDDTRHIRFDDRQPRLDERSFLALDWDPELKKRYFDDSAAEDFEKHESVEYKPP
KKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYS
RYMRDKLDTLVGFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDD
GKWYYFDDSSVSIACEDQIVSKAAYVLFYQRQDTISGTGFFPLDRETKQGASAATGIPLE
SDEDSNENDNDIENENCMHTN
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggaggcgcggcggatctggagacccagcgcacggacgtggccgcgctgctc
aaaaccgccctccgcaagggcgacacctggtatcttgtggatagtcgttggttcaaacag
tggaaaaaatatgttggtttcgacagctgggacaaatatcaaatgggagatcagaatgtg
taccctggtcctattgataattctggacttctcaaagatggtgattcccagtctctcaaa
gaacatctcattgatgagctggattacatcctgttgcccactgaaggctggaataggcta
gttagctggtacacgctaatggaaggtcaagaaccaatagcacgcaaggttgttgaacag
ggtatgtttgtaaagcactgcaaagtagaagtatatctgacagaattaaagctttgtgaa
aatggaaatatgaacaatgttgtcacacgaagatttagtaaagctgatacaatagataca
attgaaaaagagataagaaaaatcttcaatattccaggtgaaaaagagaccagattgtgg
aacaaatacatgagtaatacctttgaacctttgaataaaccagatagtaccatacaagat
gctggtttataccagggacaggtactggtaatagaacagaagaatgaggatggaacatgg
ccaagaggttcttcaactcctaagtccccaggtgcatccaatttttcaactttaccaaag
atctctccatctctatcaaataattataacaacatgaacaacagaaatgtgaaaaattca
aattattgtctctcatcatatactgcttataagaattacgattattcagagccaggaaga
cataatgaacagccaggcctgtgtggcctgagtaacttggggaatacatgtttcatgaat
tcagcaattcagtgtctgagcaacacacctcctctaacagaatattttctcaatgataaa
taccaagaagagttgaattttgacaatcctttaggaatgcgtggtgaaattgcaaaatct
tatgcagagctcatcaagcaaatgtggtcaggaaaatacagttacgttacgccaagagca
tttaagacacaagtgggacgatttgcaccacaattttctggttatcagcaacaagattgt
caagagctactggcttttctcctggatggcttacatgaggatttgaatcgaattaggaaa
aagccttatattcagttaaaagatgcggatggaagaccagacaaggtagttgctgaagaa
gcctgggagaaccatttaaaaagaaatgattccatcattgtagatatatttcatggcctt
tttaaatccactcttgtctgtcctgaatgtgctaagatttctgtaacctttgatccattt
tgttatttgacacttccattacccatgaaaaaagaacgcactttggaagtttttttagtc
agaatggatccacttgctaagcctatgcagtacaaagtagtagttccaaaaattggaaat
atattggatctttgcacagcattgtcggctctgtcaggtgttgctgcagataagatgatt
gttactgatatatacaatcacaggttccacaggatatttgccatggatgaaaatctgagt
agtattatggaacgtgatgacatttatgtgtttgaaatcgctatcaatagaacagaagat
acggaacaagttataattcctgtttgtttaagggaaaagtgcaggcacactagctacagc
catagtggttcctcattgtttggtcaaccttttctcatagcagtgcctagaaacaacact
gaagataaactgtataacctgctgctgctaagaatgtgccgatatgtaaaaacatgcact
gaaactgatgacactgaaggatccctacggtgctgtaaggaacatggtatcaatggtaac
ggcccaaatggaatacatgaagagggttctccaagtgaaatggaaacagatgaacaggat
gatgaatccagccaggatcaggagcttccttcagagaacgaaaacagccaatcagaagac
tcagttggaggtgacaatgactctgaaaatggattatgtactgaagatacttgcaaaggt
caaccactcacgggacacaaaaagcgattgtttacattccagttcaataatttaggcaat
actgacataaattacatcaaagatgataccaggcatattagatttgatgacaggcaacct
aggcttgatgaaagatctttccttgctttggattgggatcctgagttgaagaagagatac
tttgatgatagtgcagcagaggattttgaaaaacatgaaagtgtggaatataagcctccc
aaaaagccttttgtgaaattaaaagattgcattgagctgttcacaacaaaggaaaaacta
ggtgctgaagacccatggtattgtccaaactgtaaagaacatcagcaagctaccaaaaag
ttagacttgtggtcacttcccccagtactggtagttcatctaaaacgcttttcctatagc
agatacatgagggacaagttggacacattggttggctttccaataaatgatttggacatg
tcagagttccttattaatccaaacgcaggcccttgccgctacaacttgattgctgtctcc
aatcactatggaggaatgggaggagggcactatactgctttcgcaaaaaataaagacgat
ggaaaatggtactactttgatgacagcagcgtgtcaattgcatgcgaggatcaaatagtg
tccaaagcagcgtatgtgctcttctaccagagacaggatacaatcagtggaactggcttt
tttcctcttgaccgggaaactaaacaaggtgcttcagctgccacaggcatcccactagag
agcgatgaagacagcaatgaaaatgataatgatatagaaaatgaaaattgtatgcacact
aactaa

DBGET integrated database retrieval system