KEGG   Meleagris gallopavo (turkey): 100542227Help
Entry
100542227         CDS       T01523                                 

Gene name
PLCD1
Definition
(RefSeq) phospholipase C, delta 1
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100542227 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100542227 (PLCD1)
   04070 Phosphatidylinositol signaling system
    100542227 (PLCD1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100542227 (PLCD1)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100542227 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 781 aa AA seqDB search
MQCIRRQPKRSVSQENILREQSRRVAALNGIRLGLKDDKDLKFLLKGSQLLKVKSSSWRK
ERFYKLQEDCKTIWQESKKMLRSPDSQIFSIEDIRDVRSGHKTEGMEKYAKDVPEYRCFS
IIFKDQRKNLDLIASSEDDANHWVCGLGKIIAHSNSMNQKQKLQHWIHTCLRKADKNKDN
KMSFKELKNFLKEVNIEVDDYHAKEIFQYCDKSKTEALEDDEIEEFYKILTERKEIDTIF
QKYSDAEGLMSCQNLVRFLYETQQEEDAVVAAPPLIQRYEPSERAKKRNAMTKDGFLMYL
LSDDGNIFNTSHRKVYQDMTQPLSHYFVSSSHNTYLMDDQLTGPSSTEAYIRALTKGCRC
VELDCWDGPNSEPIIYHGYTLTSKILFCDVIKAIKNYAFKTSPYPVIISLENHCSLDQQK
VMAQHMTTILQDMLLVAPIDGSKSQFPSPEQLKGKILVKGKKLSRQEDPTGTNGNNNLEA
EDVSDEDEAAEMEDESVKTEVQQKGKRDTLKLAKELSDTVVYCKSVHFNGFEDPSHPRAF
YEMSSFTESKALKLAQESGNSFILHNIRHLSRIYPAGWRTDSSNYNPVDLWNVGCQIVAL
NFQTGGTEMDVYQGRFQDNGFSGYVLKPEFLRDEQTKFNPKSITEGTWGTKKKLLLKIIS
GQQLPKVNKSKNSIVDPRVTIEIHGVQQDNNKKQTKVIENNGFNPKWDEEFTFDIEIPAL
ALVRFVVEDFDMSTKNDFIGQYTVPFTSLKQGYRHIHLLTKNGDPYSSSTLFVYVNIQDC
D
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcatccgaaggcagcccaagcgcagcgtgtcccaggagaacatcctgcgggag
cagagccgtagagtggccgcgttgaatggcatcaggctgggcttgaaagatgacaaggac
ctgaagttcctcttgaaaggcagccagctgctaaaagtgaagtcaagctcttggaggaag
gagcggttttataagctccaggaggactgcaaaaccatatggcaggaatcaaagaagatg
ctgaggtctccagactcacagatcttctctattgaagatattcgggatgtgaggtcaggc
cataaaacagaaggtatggaaaaatacgccaaggatgtaccagagtatcgctgcttttcc
atcattttcaaagaccagcggaaaaacctggacctcattgcaagttcagaggatgatgcc
aaccactgggtctgcggccttgggaaaatcatagcccacagcaactccatgaaccagaaa
cagaaactccaacattggattcacacctgcctgcggaaagctgataagaacaaagacaac
aagatgagctttaaagagctcaagaacttcctgaaagaagtgaacattgaagttgatgac
tatcatgccaaggagattttccagtactgtgacaagtccaaaacagaggctctggaggat
gatgagatagaggaattttacaagatactgacagagagaaaggaaatagacacaatcttc
caaaagtactcagatgcagaagggctcatgtcctgccagaacctggtgaggttcctctat
gagacacagcaagaagaagatgctgttgttgctgctcctcccttaattcagagatacgag
cccagtgaacgagccaagaagcgtaatgccatgaccaaagatggtttcctgatgtacttg
ctgtctgatgatgggaatatattcaacacatcccaccgtaaagtttaccaggacatgact
caacctctcagtcactactttgtatcatcctcacacaatacctaccttatggatgaccag
cttacaggccctagcagcacagaagcctacatcagagccctcaccaaaggttgccgctgt
gtggagctggactgctgggatggccctaactcggaacctatcatttatcatggctacact
ctcacctccaagatcctcttctgtgatgtcattaaggccatcaagaactatgctttcaaa
acttcaccgtaccctgtcatcatctccctggagaaccactgcagcctcgaccagcagaag
gtcatggctcagcacatgacaacgatcctgcaggacatgctcctggtcgccccgattgat
ggaagcaaatcacagttcccctccccagagcaactgaaagggaagatccttgtgaaaggc
aagaagctgagcagacaggaagaccccactgggacaaatgggaacaacaacctggaggct
gaggatgtctctgatgaagatgaagcagctgaaatggaagatgaatctgtgaagacagag
gtgcagcagaaagggaagagagacaccctcaagctggccaaagagctgtcagacacagtt
gtctactgcaagagtgttcatttcaatggctttgaagaccccagtcaccctcgagctttc
tatgagatgtcatcgttcacagagagcaaagctctgaaactagctcaggagtctggaaac
agttttattcttcataacatcaggcacttgagccgaatataccctgcaggctggaggaca
gattcttccaactacaatcctgttgacttgtggaacgtcggctgccagattgttgcccta
aatttccagacaggaggcacagaaatggatgtctaccagggccggttccaggacaatggg
ttttctgggtatgtcttaaagccggaattcctccgggatgagcaaaccaaattcaatcca
aaatccatcacagaaggaacatgggggacaaagaagaagcttctacttaaaatcatctct
ggtcagcagctgcccaaagtaaacaagagcaaaaactccatcgttgatcctagggtaaca
attgagatccatggcgtccagcaggataacaacaagaagcagaccaaagtcattgaaaat
aatggcttcaacccaaagtgggacgaagagtttacatttgacatagagatccctgcactt
gccctggtccgatttgtggtagaagactttgacatgtcaaccaagaacgacttcattggg
cagtatactgttcccttcaccagtctgaagcaaggttaccgccacattcaccttctgacc
aagaacggagacccgtactcctcctccaccctctttgtgtatgtcaacatccaggactgt
gattag

DBGET integrated database retrieval system