KEGG   Meleagris gallopavo (turkey): 100542241Help
Entry
100542241         CDS       T01523                                 

Definition
(RefSeq) CREB-binding protein-like
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100542241
   04330 Notch signaling pathway
    100542241
   04350 TGF-beta signaling pathway
    100542241
   04630 Jak-STAT signaling pathway
    100542241
   04068 FoxO signaling pathway
    100542241
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100542241
  Cellular commiunity
   04520 Adherens junction
    100542241
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    100542241
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100542241
   05168 Herpes simplex infection
    100542241
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100542241
Transcription factors [BR:mgp03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100542241
Mitochondrial biogenesis [BR:mgp03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100542241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
16
AA seq 2046 aa AA seqDB search
MRSSASGILTCAALMRTAPGADFLLFFLFIALLGSPAGGMQNSIGSVGTGQQNNPSLSNP
NPIDPSSMQRAYAALGLPYGNQPQTQLQPQVQGQQPAQPQAHQQMRTINALGANQMNLPT
GGITTDQQASLISETALPTSLGTNNPLMNDGTNSGNVGNLSSMPTAAPPSSTGVRKAWHE
HVTQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHLL
AEKIYKIQKELEEKRRSRLHKQGILGTQPALQTPGPQPPGIPQVAAAMGQAQPVRPPNGP
MSMTTVPISRMQVSQGMNQFNPMSIGNVQMSQAPMGPRAASPMNHPVQMNNMGAVPAMAM
SPSRMPQPQNMMGAHSNNMMGQAPTQNQFLPQNQFPASTGAMNVNNVGMGQTAAQAGVAQ
QGQVPSAALPNSMNMLGPQSGQLCPPVTQPPLHQTTPPVSTAAGMPPIQHQTPTGMTPPQ
PAAPTQPSTPVSSSGQTPTPTPGSVPNATQTQSTPTGQTAAQAQVTPQPQTPVQPQSVPT
PQPSQQQPTSVQAQPPGTPLSQAAASIDNRVPTPASVASADTNSQQLGPDAPMLESKSEV
KTEETEPETSETQVEAKTEVEEDLQGSSQIKEETDGTELKQEPMEIEEKKPEIKVDAKEE
EESGTNGTTSQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGI
PDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCTKLA
EVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFT
EIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIW
PSGFVCDNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVV
ASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCP
PPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDY
IFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEG
DFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISR
ANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMD
GRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTV
CEDYDLCINCYNTKSHDHKMVKWGLGLDDESNSQGEQQSKSPQESRRLSIQRCIQSLVHA
CQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPF
CLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSATPGTPTQQPSTPQT
PQPPPQPQPSPVSMSPAGFPSVSRTQPPXTVSAGKPANPVAAPPPPAQPPPAAVEAARQI
EREAAQQQQQLYRVNNINNGLPPGRPGLVNPTVGSVSQMQQVGMNVPRPGPVSGAVMSNM
QAGQWQSPPMPQQQAMQPGMARPVMPMATAQAVAGPRMPGVQQPPRSIPPNALQDLLRTL
KSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQAGIQPQPGMQQPQTGM
QQPGMHAQPGLQNMNAMQAGVQRPSVPPQQQGIGAMNPQAQGINIMNPGHNTSMASMNHP
QYREILRRQLLQQQQQQQQQQQGGAGMAAGMAGHSQFQQPQGPGGYPQAMQQQRMQQHIS
IQGGSMGQMAQMGQLNQMGQPGLGADGTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSP
QQHMLSGQPQASHLPGQQIATSLSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHV
SPQTGSPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNTPNRSALSNELSLVGDTTGDTLE
KFVEGL
NT seq 6141 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagctcagccagtggcatcctgacatgcgccgcgctcatgcgcaccgcgcccggc
gcggattttctattattctttctttttatagccctcttagggtctccagctggtggaatg
cagaattccattggttcagttggaacaggccagcagaataatccatcgctaagtaatcct
aatccgattgaccccagctccatgcaacgagcctatgctgctcttggactcccatatggc
aaccagcctcagacacagttgcagccccaggtacaaggccagcagcccgcacagcctcag
gctcaccagcaaatgaggaccattaatgcattgggagccaaccagatgaaccttcccaca
ggaggaataacaacagaccagcaagctagtctaatttctgaaactgctcttccaacatcc
cttgggacaaataaccccctaatgaatgatggcacaaattctggcaatgttggaaacctc
agctcaatgccaacagctgcacctccttctagcaccggggtaaggaaagcatggcatgaa
catgtcactcaggacctgcgcaatcatttagtgcataaacttgtccaagccatcttcccc
acgccggatccagcagcactgaaggatcgccgcatggagaacttggtggcttatgcaagg
aaagttgaaggagatatgtatgaatctgccaacagtagggatgaatactatcacttatta
gcagaaaaaatctacaagatacaaaaggagctggaagagaagcggaggtctcgtctgcat
aaacaagggatcttgggaacgcagccagccttacagacgccaggacctcagccccctggc
atcccacaggtggctgctgccatgggccaggcacagcctgtgaggcctcccaatgggcct
atgtccatgacaactgtgcctataagtcgtatgcaggtttctcaaggaatgaatcagttt
aaccccatgtccatagggaatgtacagatgtcacaagcacccatgggaccccgtgcagct
tctccaatgaaccatcctgtacagatgaacaacatgggcgctgttcctgcgatggcaatg
tctccttcccgaatgcctcagccacagaacatgatgggagcccattccaacaacatgatg
ggtcaggctcctacccagaaccaattcctgcctcagaatcagtttccagcttccacaggg
gctatgaatgtgaacaacgttggcatgggtcagacagcagcccaggcaggggtggcacag
caggggcaggttcccagtgctgctcttcccaactccatgaacatgctaggaccacagagt
ggtcagctatgcccaccggtgacccagccacctctgcatcagactacacctcccgtttcc
actgctgctgggatgccgcctattcagcaccaaacaccgactggaatgactcctcctcag
ccagcagcacccactcagccatccacaccagtctcatcttcaggacaaacccctacaccg
accccgggttctgttcccaacgcgacccaaacacaaagcacgcccacggggcagactgca
gcacaggctcaagtcacaccgcagcctcagaccccagttcagccccagtctgtgccaacc
ccacagccatcccagcaacagccaacatctgtgcaggcacagccacctggcactccacta
tcccaggcagcagctagtattgataacagggtccccacccctgcctcagttgctagtgct
gatacgaattcccagcaactaggaccagatgcaccaatgctagaaagcaaatcagaagtt
aaaactgaagaaactgagccagagactagtgagacacaagtggaagctaagactgaggtg
gaggaggatttacaaggatcttcacaaataaaagaagaaacagatggaactgagctgaaa
caagagccaatggaaatagaagaaaagaagcctgaaataaaagtagatgccaaggaggaa
gaggaaagtggcactaatggaaccacttcacaatccacatcaccatctcagccccgcaag
aaaattttcaagcccgaggagctgcgccaggcgctgatgcctacgctggaagccctgtac
cggcaggacccggagtctctgcctttcaggcagcccgtggatccccagctcttagggatt
ccggactactttgacattgtgaagaatcctatggacctctcaaccattaaacgtaaatta
gatacggggcagtaccaggagccctggcagtatgtggacgatgtttggctgatgttcaac
aacgcctggctttacaatcgcaagacttccagggtctataagttttgcactaaacttgca
gaggtgtttgaacaagaaattgatcccgttatgcagtcccttggctactgttgtgggcgc
aagtatgagttttctccacagaccttgtgctgctatggcaagcagctgtgtactatccct
cgtgatgctgcctattacagctaccagaataggtatcacttctgtgagaagtgtttcact
gaaatccagggggagaatgtcaccctgggtgatgacccttcccagcctcaaacaaccatc
tctaaagatcagtttgagaagaagaagaacgacacgctagatcctgagccgtttgttgac
tgcaaagagtgtggtcggaagatgcaccagatttgtgtcttacattatgatattatttgg
ccttcagggtttgtttgtgataattgtctgaagaaaactggtagaacacgtaaagaaaac
aagttcagtgctaaaaggctgcagaccacccgcttaggaaaccatttggaagacagagtg
aacaagtttttgaggcgacagaatcatcctgaagctggagaggtttttgtcagagtggta
gcaagttcagataagacagtagaagttaaaccagggatgaaatccagatttgtggattct
ggtgagatgtcagaatccttcccttaccgtaccaaagctctgtttgcatttgaggagata
gatggagtagatgtctgcttctttggcatgcatgtgcaggagtatggctcggactgcccc
cctccaaacacaagacgtgtgtacatatcctatctagatagtattcatttcttccgcccc
cgttgtctccgaactgcagtttatcatgaaatcctcattggatatttggagtacgtgaag
aaacttgggtatgtgacaggacacatctgggcctgtcccccaagtgaaggagatgactat
atttttcattgccatccacctgatcagaaaattcccaagcccaaacgcttacaagaatgg
tataagaagatgctggacaaggcatttgctgagagaatcattcatgactacaaggacatc
ttcaaacaagcaactgaagacaggctgacgagtgccaaggagctgccttactttgaaggt
gatttctggcccaatgtgctggaagaaagcattaaagagctggagcaggaggaggaggaa
aggaagaaggaagaaagcactgcagctagtgaaacaacagagggaagccagggtgacagc
aaaaatgccaagaaaaagaacaacaaaaaaaccaacaagaataagagtagcatcagcaga
gctaacaagaagaaacccagcatgccaaacgtgtccaacgatctgtctcagaagctgtat
gccaccatggagaagcataaagaggtcttttttgtgattcatttacatgccgggcctgta
attaacactctgcctcccattgtggaccccgacccactgctgagctgtgatctgatggat
ggcagggatgccttcctcaccttagccagagataagcactgggagttctcctcgctgcgc
cgatccaagtggtccacgctctgcatgctggtagagctgcacacccaggggcaggaccgc
tttgtctacacgtgcaatgagtgcaagcatcacgtggagaccaggtggcactgcactgtc
tgtgaggactacgacctctgcattaactgctacaacactaagagccatgaccacaagatg
gttaagtggggcctgggtctggatgatgagagcaacagccaaggggagcagcagtcaaag
agcccccaggagtcgcgacggctgagcatccagcgctgcattcagtcccttgtccacgcc
tgtcagtgtcgcaatgcaaactgctcgctgccatcctgccagaagatgaaacgggttgtc
cagcacaccaagggctgcaagcgcaagaccaacggcggctgcccggtgtgcaaacagctc
atagctctttgctgctaccatgccaaacactgccaagagaacaaatgccccgtgccattc
tgtctcaacatcaaacacaagctccggcagcagcagatccagcaccgcctgcagcaggct
cagctcatgcgcagaaggatggctaccatgaacacccgaaacgtgcctcagcaaagtttg
ccttctcctacctcagcaacgcctggtacccccacacagcagccaagtacgccgcagacg
ccgcagcctcctccccagccccagccttcccctgtaagtatgtcaccggctggctttccc
agtgtgtccagaactcagcccccanctaccgtttcagcaggaaaacccgcaaacccggtt
gccgcgcctccacctccggctcagccgccgccggccgcggtggaagcggctcggcagatc
gagagagaggctgcccagcagcagcagcagctctacagggtcaacaacatcaacaatggt
ttgcctcccggtcgcccggggcttgtaaacccgacggtgggttcggtgagccagatgcag
caggtcggcatgaacgtgccccggcccggccccgtcagcggcgcggtgatgtccaacatg
caggctgggcagtggcagtcgcctccgatgccgcagcagcaggcgatgcagccggggatg
gcgaggccggtgatgccgatggcgacggcgcaagcggtggctgggccgaggatgccgggc
gtgcagcagccgccgcggagcatccctccaaatgcacttcaggacttgctgaggaccttg
aaatcgccgagttctccgcagcagcagcaacaggttcttaatatccttaagtccaaccct
cagcttatggcagcttttataaagcaaagaacggccaaatacgtggctaatcagcccggg
atgcagccgcaggcggggatacagccccagcctggcatgcagcagccgcagaccggcatg
caacagccgggcatgcacgctcagccgggattgcagaacatgaacgcgatgcaagcagga
gtgcagagaccaagcgttcctccccagcagcaagggataggagctatgaatccgcaggcg
caaggaatcaacatcatgaaccccggccacaacactagcatggcaagcatgaatcatccg
cagtatcgagaaatcctgaggaggcaactactgcagcagcagcaacagcagcagcagcag
cagcaaggaggggctggcatggcggcggggatggccggccacagccagttccagcagccc
cagggaccgggaggttaccctcaagccatgcagcagcagcggatgcagcagcacatatcc
atacagggggggtccatgggacagatggctcagatggggcagctgaaccagatgggccag
cccggcctgggggcggacggcactcccaacattcagcaagcgctgcagcagaggatcctg
cagcagcagcagatgaagcagcagataggctctccgggccagcccaaccccatgagccca
cagcagcacatgctctcaggacaaccgcaggcgtctcatctccccggccagcagatcgcc
acctccctcagcagccaggtgcggtccccagcgcccgttcagtctccccgtccccagtcc
cagccgccacattccagcccgtccccgcggattcagccccagccgtcgccgcaccacgtc
tcgccccagactggttccccccacccaggactcgcagttactatggctagctccatggat
cagggacacttgggcaacccggaacagagtgcaatgcttccacaactaaacacccccaac
aggagtgcgttgtcaaacgaattgtctctggtcggtgacaccaccggggacacgttagaa
aaatttgtggagggtttgtag

DBGET integrated database retrieval system