KEGG   Meleagris gallopavo (turkey): 100542272Help
Entry
100542272         CDS       T01523                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1-like
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100542272
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100542272
   04370 VEGF signaling pathway
    100542272
   04020 Calcium signaling pathway
    100542272
   04070 Phosphatidylinositol signaling system
    100542272
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100542272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1290 aa AA seqDB search
MGTVLTLFYQKKSQRPERRTFQVKLETRQIIWSRTPEKVEGDIDIREIKEIRLGKNSRDF
ERYPEDARKLDFAMCFIILYGMDFRLRTLSVAAFCEEDINLWITGLNWLVADTQKAQTPL
QIERWLRKQFDGMDRSREGSITVKDLKAMLPQVNYRVPNMRFLRDKLVEVEARNEMTFSH
FIQFYKNLMFDAQKSQDMIVDMSGNASRNVSGVVGGDVNRNGNQGCSDVVQCSLPHIRGQ
HFLLICPRNVDRPELCQVSLYDFQKFLLHDQKEPWASDVGMVRDYMCSYLKDGSIDAAEP
SFQLDEFLTYLFSKENMVMDAKYERVVPEEMNHPLSQYWISSSHNTYLTGDQFSSESSLE
AYARCLRMGCRCIELDCWDGPDDLPIIYHGHTLTSKIKFLDVLHTIKEHAFVTSEFPIIL
SIEDHCSIVQQRNMASHFKKVFGDMLLTKPVDINADELPSPTQLKKKILIKHKKLVEGNL
YEEVSTASYSENDISNSIKNGILYLEDPIDHTWSPHYFVLTSNKIYYSEETSRYQFNEDE
EEVEQKEEFNNNELHFTEKWFHGKLGGGRDGRQIAEKLLHEYCTETGGKDGTFLVRESET
FVGDYTLSFWRSNRVQHCRIHSRQEAGSTKFYLTDNLVFDSLYSLICHYREVPLRCNEFE
MRLTDPVPQPNAHESKEWYHASLTRLQAEHMLMRVPRDGAFLVRKRSEPNSYAISFRAEG
KIKHCRIQQEGRLFMLGSSAEFESLVDLVSYYEKHPLYRKMKLRYPINEETLEKMGTTEL
DYGALYEVRTPHFYVEANKMPMARCTVKALYDYKAQREDELSFCKQAIIHNVDKQDGGWW
RGDYGGKKQLWFPANYVEEIVSTQAQEQDEAHSSENSPLGNFLKGFIDVPSCHVVISKDG
RSSKPFVFTIHSQQMSHAAQSLDVAADTQEELSEWVAKIREATQNADARMQEGKIMERRK
KIALELSELVVYCRPVPFDEDKIGTDKACYRDMSSFPETKAEKYANRSKGKKFLQYNRRQ
LSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQLNQALFMLGGRSGYVLQPD
IMRDETFDPFDKNSLKIVEPITVQLQILGARHLPKNGRSIVCPFVEVEVCGSEYDNSKNK
TDVVADNGFNPVWLFKQFVFDINNPEFAFLRFVVYEEDMFSDPNFLAQATFPIKGLKTGY
RSVPLKNSYTEDLELAALLIHIEIINAKEEDEENLYSSIQQLRDRASELSSQVSSYERTN
NCDSRYQQRLDELRAAQERLMELTEVRNRK
NT seq 3873 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgtcctcactttattctaccagaagaagtcacagaggccagagcgaaggaca
ttccaggtgaagctggagacccgacagattatctggagtcggacacccgagaaggtggag
ggagacattgacattcgggagatcaaggagatccgcctggggaagaactcacgagacttt
gagcgttaccccgaggatgctcgcaagctcgactttgccatgtgcttcatcatcctctat
gggatggacttcaggctgcggacactcagcgtggctgctttctgtgaggaagatatcaac
ctgtggatcacaggtctcaactggttggtggcagacacccagaaagcccagaccccgcta
cagattgagaggtggctgcggaaacagtttgatgggatggaccggtcgcgggaaggaagc
attacagtgaaggacctgaaggccatgctgccccaggtgaactaccgagtgcccaacatg
aggttcctgcgggacaagctcgtggaggtggaagccaggaatgagatgaccttctcccac
ttcatccagttctacaaaaacctgatgtttgatgcacagaagtcgcaggatatgattgtg
gatatgagtggcaatgcaagcaggaatgtgagtggggttgtgggtggggatgtgaacagg
aatgggaaccagggatgcagtgatgtagtgcaatgctctcttcctcatatccgtggacaa
cacttcctgctgatatgccccaggaatgtggaccgccctgagctgtgccaggtctccctc
tacgacttccagaagttccttctgcacgaccaaaaggagccatgggctagtgatgtgggc
atggtgcgggactacatgtgttcctacctcaaggatggctccattgatgcagcagaaccc
tccttccagctagatgagttcctcacgtacctcttctccaaggagaacatggtgatggac
gccaagtatgagcgtgtggtgcctgaggagatgaaccaccctttgtcccagtactggatc
tcctcttcccacaacacgtacttgacaggagaccagttctccagtgagtcctccctggag
gcgtatgcccgctgcctgcgcatgggctgccgctgcattgagttggactgctgggatggc
ccagatgatctccccatcatctaccacggtcacacgctcacctccaagatcaaattcctg
gacgtgctgcataccatcaaggagcatgcatttgtcacatctgagttccccatcatcctc
tccattgaagaccactgcagcatcgtccagcagaggaacatggcttcccacttcaagaag
gtctttggggacatgctgctcaccaagccagttgacatcaacgctgatgagctgccctca
cccacccaactcaagaagaagatcttaatcaagcacaagaagctggttgaagggaaccta
tatgaggaggtctccactgccagttattcagagaacgacatcagcaactccataaagaac
ggcatcctctacctcgaagaccctattgaccatacctggagcccgcattattttgtactg
acaagcaacaagatctactactcggaggagacgtcacgctaccagttcaatgaagatgaa
gaggaggtggagcagaaggaggagttcaacaacaacgagctgcacttcacggagaagtgg
ttccatgggaagctgggaggtggccgtgatgggcggcagattgccgagaagctgctgcat
gaatactgcactgagacaggaggcaaggatggcaccttcctggtgcgcgaaagcgagacc
ttcgtgggtgactacaccctgtccttctggcgatcaaaccgtgtgcagcactgcaggatc
cactcacgacaggaggctggttccaccaagttctacctgacagacaacctggtctttgac
agcctctacagtctcatctgccactaccgtgaggtgccactccgctgcaatgagtttgag
atgcgcctcaccgaccccgtgccccagcccaatgcccacgagagcaaagagtggtatcat
gccagcctgacacgcctgcaggctgagcatatgctgatgcgagtccctcgggatggagcc
ttcctggtgcgaaaacggagcgaacccaattcctatgccatttcattccgggcggagggg
aagatcaagcactgccgcatacagcaggagggacgactcttcatgctgggcagctcagct
gagtttgagagcctggtggaccttgtcagctactacgagaagcatccgctgtaccgtaag
atgaagctgcgctaccccatcaatgaggagaccctggagaagatgggcactactgaactg
gactatggggctctgtatgaggtgcggacaccccatttctatgtggaggccaacaagatg
ccaatggcaaggtgcacagtgaaggctctttatgactacaaagcacagcgagaggacgag
ctgtcattctgcaagcaagccatcatccacaacgttgacaagcaggacggtggctggtgg
cggggggactacgggggcaagaaacagctgtggttcccagccaactatgtggaggaaatc
gtcagcactcaggcacaggagcaggatgaggctcattcatcagaaaacagccccctgggg
aacttcctgaagggcttcatcgacgtgccatcatgccacgtagttatctccaaagacggg
aggagctccaaaccatttgtcttcaccatccattcccagcagatgtcccacgcagcccag
tcactggacgtggccgctgacacacaggaggagctgagcgagtgggtggccaagatcagg
gaggccacgcagaacgccgatgccaggatgcaagagggaaagattatggagcggaggaag
aagatcgctctggagctctccgagctggttgtgtattgccgccccgtgccattcgatgaa
gacaagattggcacagacaaagcatgctaccgggatatgtcctccttcccggagaccaaa
gcggagaagtacgccaaccgcagcaagggcaagaagttcctgcagtacaaccggcgccag
ctcagccgcatctaccccaaagggcagcgcctggactcctccaactacgacccactgcct
atgtggatctgtggcagccagttggtggccctcaacttccagacgcctgacaagccgatg
cagctgaaccaggcactcttcatgctcggcggccgcagtggctatgtcctacaacccgac
atcatgagggatgagacgtttgaccccttcgacaagaacagcctgaagattgtggagccc
atcacagtgcagctgcagattcttggtgcccggcaccttcccaagaatgggagaagcatt
gtgtgcccctttgtggaggtagaggtgtgtggctccgagtatgacaacagcaagaacaag
actgatgttgtagctgacaatggtttcaaccccgtgtggctcttcaagcagttcgtcttc
gacatcaataaccctgagttcgccttcctccgctttgtggtgtacgaggaggacatgttc
agtgaccccaatttcttggcccaagccaccttccccattaagggtctcaaaacaggctac
cggtcagtgccactgaagaacagctacacagaggacctggagctggccgcactcctcatc
cacattgagatcatcaatgccaaggaggaagacgaggagaacctctactcatccattcag
cagttgagggaccgtgccagtgagctctccagccaggtctccagctatgagcgcaccaac
aactgtgactcacgctaccagcagcgcctcgatgagctgcgagcagcccaagagaggctg
atggagctcactgaggtccgcaaccgcaagtga

DBGET integrated database retrieval system