KEGG   Meleagris gallopavo (turkey): 100542277Help
Entry
100542277         CDS       T01523                                 

Gene name
ASNS
Definition
asparagine synthetase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100542277 (ASNS)
Enzymes [BR:mgp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     100542277 (ASNS)
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C44
   100542277 (ASNS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 490 aa AA seqDB search
MLTHTTKYTLTQLQKQFGFEYQTLVDGEVILHLYNRGGIEQTASMLDGVFAFILLDTANR
KVFLARDTYGVRPLFKVLTDDGFLGVCSEAKGLINLKLSTSLFPKVEPFLPGHYEVLDLK
PSGKVASVEIVKFHSYKDEPLHAACDTVENLPSGFDLETVKSNIRVLFENAVRKRLMAHR
RIGCLLSGGLDSSLVAAVLLKLMKEMNIKYPLQTFAIGMENSPDLLAARKVAAHIGSEHH
EVIFNSEEGIQAVEEVIFSLETYDITTVRASIGMYLVSKYIRKKTDSVVIFSGEGSDELT
QGYIYFHKAPSPEEAAEESERLLKELYLFDVLRADRTTAAHGLELRVPFLDHRFTSYYLS
LPAELRIPKNGIEKYLLRQSFEDSNLLPKEILWRPKEAFSDGIASVKKSWFSILQDYIDQ
QVDDLLLEKAAEKYPFNPPRTKESYYYRQIFEKHYPGRSNWLPHYWMPRWVKATDPSART
LKHYKSATQE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgctcacacacaccaccaaatacaccctgacccagttgcagaagcagtttggatttgag
tatcaaacactggtggatggtgaggttatccttcatctgtacaacagaggagggatagaa
caaacagcatccatgctggatggtgtatttgctttcatccttctggacacagcgaacaga
aaagtgtttcttgcaagagacacgtatggagtcagaccactgtttaaggtgctgactgat
gatggatttttgggtgtctgttctgaggcaaaaggacttatcaacttaaagctttcaaca
tccttatttcctaaagtggaaccatttcttcctggtcattatgaagtgctggatttgaag
ccctctggcaaggttgcatcagtggaaatagtaaagtttcatagttataaagatgaacca
ctccatgctgcttgtgatacagtggaaaatctgccttcaggctttgaccttgaaacagtg
aagagcaacatccgtgttctgtttgaaaatgctgttagaaagcgtttgatggctcacaga
aggattggttgtcttttgtcagggggcttagattccagcttggttgcagctgttcttctg
aaactgatgaaagaaatgaacataaaatatccactacaaacctttgcaattgggatggaa
aacagtcctgatttactggctgccagaaaggtggcagcgcatataggcagcgaacaccat
gaagtaatatttaattctgaagagggaattcaggcagtagaggaggttatcttttctttg
gaaacctacgatataacaacagtaagagcttcaattggtatgtatcttgtctccaaatat
atacgcaagaaaacagacagtgtggtcattttttcgggagaaggatcagatgagttgact
cagggatatatatatttccataaggcaccatctcctgaagaggctgcagaagagagtgag
aggcttctgaaggagctctacctgtttgatgtacttcgtgcagacagaactactgcagca
catggtcttgagctaagagtcccatttctggatcatcgctttacttcttactatttatct
ctaccagcagaactgcgaatcccaaagaatggaatcgagaaataccttttaagacagtcc
tttgaagattctaacttgcttcccaaagaaatactttggagacccaaagaagctttcagt
gatggtatagcatcagtaaagaaatcctggttttctattcttcaagactatattgatcaa
caggttgatgaccttctactggaaaaggcagcggagaaatatcctttcaatcctcctaga
acaaaagaaagttactactaccgtcagatctttgagaagcactacccagggcgaagcaac
tggctgccccactactggatgccaagatgggttaaagcaactgatccttcagctcgcaca
ctgaaacattacaagtcagctactcaagagtag

DBGET integrated database retrieval system