KEGG   Meleagris gallopavo (turkey): 100542338Help
Entry
100542338         CDS       T01523                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Lysosome
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:mgp04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:mgp04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
17
AA seq 1672 aa AA seqDB search
MAQILPIRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMSDPTS
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHAMAEEVIFWKWISVNTVA
LVTETAVYHWSMEGESQPQKMFDRHASLAGCQIINYRTDEHQKWLLLIGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKIEGNAKPSTLFCFAVRSPAGGKLHIIEVGQPATGN
QPFVKKAVDVFFPPEAQTDFPVAMQIGIKHGVIYLITKYGYIHVYDLESGVCIYMNRISA
DTIFVTASHEPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRMAIRSNLAGA
EELFARKFNTLFAQGSYADAAKVAASAPKGILRTSDTIRKFQSVPAQPGHASPLLQYFGI
LLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKTADPTLALSVYL
RANVPNKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRSVMRVSPEQGLQFSQMLVQDE
EPLANINQIVDVFMENSLIQQCTSFLLDALKNNRPAEGHLQTRLLEMNLIHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLRAMLSANIRQNLQLCVQVASKYHEQLGTQSLVELFESFKSYEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNSLQKYIEIYVQKVNPSRIPAVVGGLLDVDCSEDVIKNLIMVVRGQF
STDELVAEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVRRKDPELWANVL
EENNPFRRQLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELYEEAFAIFRKFDVNTS
AIQVLIEHIGNLDRAYEFAERCNEPAVWSQLARAQLQKNLVKEAIDSYIKADDPSAYMEV
VQAANRNDNWEDLVKFLQMARKKARESYVETELIFAFAKTNRLSELEEFISGPNNAHIQQ
VGDRCYEEDMYEAAKLLYNNVSNFARLASTLVHLGEYQAAVDSGRKANSTRTWKEVCFAC
VDGREFRLAQICGLHIVIHADELEELISYYQDRGYFEELIALLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIIAKVANVELYYKALQFYLDYKPLLINDLLLVLSPRLDHTRTVNFFS
KVNQLLLVKPYLRSVQNHNNKGVNEALNNLLTQEEDYQGLRASIDAYDNFDNIALAQRLE
KHELIEFRRIAAYLYKGNNRWKQSVELCKKDHLYKDAMQYAAESKDVELAEKLLQWFLEE
GKQECFAACLFTCYDLLHPDVVLELAWRHNIMDFAMPYFVQVMREYLTKVDNLDASESLR
KEEEQVTEPTPIVFGQQLMLTAGPSAVPPQTNFPYGYTAPGFTQPPVYGFNM
NT seq 5019 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatcttgcctattcgcttccaggagcacttccagctccaaaatttgggcatt
aacccagcaaacattggattcagcaccctaacaatggaatctgacaagttcatttgcatc
agggagaaagtgggagagcaagcacaagtagtaataattgacatgagtgatccaacatca
cctatcagacgtccaatttctgctgaaagtgccatcatgaatccagcctctaaagtaatt
gcactaaaagctggaaaaacacttcagatttttaacattgaaatgaaaagtaaaatgaaa
gctcacgctatggcagaggaggtgatcttttggaaatggatatctgtgaatacagttgcc
ttggtgacagagacggcagtctaccactggagcatggagggagaatctcagccccaaaag
atgtttgacaggcatgctagtcttgcaggctgccaaatcatcaattacagaactgatgaa
catcaaaaatggctgttgctgataggaatttcagcacagcaaaatcgtgtggttggtgca
atgcagctttactctgttgatagaaaagtctcccaacctatagagggccatgcagcagct
tttgcagaattcaaaatagagggaaatgccaaaccttccaccctcttttgttttgctgtg
aggagtcctgcaggaggcaagcttcacataattgaagtgggtcaaccagctactggaaat
cagccatttgttaagaaagctgttgatgtgtttttcccacctgaggcacagacagacttt
cctgtggcaatgcagattggaattaagcatggtgttatctacctgatcacaaagtatgga
tatattcatgtgtatgacttggagtctggagtttgcatctacatgaaccgtattagtgcc
gacactatttttgtcacagcttctcatgaacctacctcaggcattattggtgtcaacaaa
aaaggacaggtgctttctgtatgtgttgaggaagacaacattgtgaactatgctacaaat
gttctccagaatcctgatttgggtctgcgtatggctatacgtagtaatcttgctggtgca
gaggaattatttgccagaaagtttaacacactgtttgctcaaggaagctatgcagatgct
gctaaagtagctgcatctgcaccaaagggaattctacgtaccagtgatacaatcaggaag
tttcagagtgtaccagctcagccagggcatgcctctccactgctccaatactttggaata
ttgcttgaccagggacagctgaacaagtttgagtctctggagctctgtcgccctgttcta
cagcaaggccgcaagcagctgctagagaaatggctgaaggaagacaagctggagtgttca
gaggagctgggagacttggtgaagacagctgacccaacccttgcgctcagtgtctatctt
cgtgctaatgtgccaaacaaagtgattcagtgctttgctgaaactggtcaattccagaaa
atagtactgtatgctaaaaaggttggctataccccagactggatcttcttgctgagaagt
gtgatgagagtcagtcctgagcagggcctgcagttctctcagatgctggtacaggatgag
gagcctctggctaacattaaccagattgtggatgtgttcatggagaacagtcttattcag
caatgcacatcctttctgttggatgctttgaaaaataaccgcccagcagaaggccacctt
cagactcgtctgctggaaatgaacttgattcatgccccacaggttgcagatgctatcctt
ggaaaccaaatgtttacacactatgatcgtgctcatattgcccagttatgtgaaaaggca
ggcttgctccagcgagctttggaacactacactgatctctatgatattaaacgtgctgtt
gttcatactcatctcttgaatcctgagtggcttgtgaatttctttggctctctctctgtt
gaagactctgtagaatgcttgcgtgctatgctgtcagccaacattaggcaaaacttacaa
ctctgtgtacaggttgcttctaaatatcatgagcagcttggcacccagtctcttgtggag
ctttttgaatctttcaaaagctatgaaggactgttctatttcttgggttccattgtaaac
ttcagccaggatccagatgttcacttcaaatatatccaggcagcttgcaaaactggtcag
ataaaggaagtagaaagaatctgccgtgaaagtaactgctataacccagaacgggtgaag
aactttctgaaggaggcaaagctaacagaccagcttcctctgatcattgtctgtgatcga
ttcgactttgttcatgacctggtgctctacttatatcgcaatagtctgcagaagtatata
gagatctatgtacagaaggtgaaccccagccgcataccagcagtagttggagggcttctt
gatgtggattgttctgaagatgtcattaagaacttgatcatggtggttagaggccagttc
tcaacagatgagctggtggctgaagtggaaaaaagaaatcggcttaaattgctgctgcca
tggcttgaatcaaggattcatgaaggctgcgaagaacctgcgactcataatgccttggcc
aaaatctacattgacagtaataataatccagaacggttccttcgtgagaatccatactat
gacagtcgtgtagttggcaaatactgtgaaaagagagaccctcatctggcctgcgttgca
tatgagaggggccagtgtgatctggaactcataaaggtatgcaatgagaactcactattt
aagagtgaggctcgctatctagtacgcaggaaggaccctgaactctgggcaaatgttcta
gaagaaaacaacccattcagacgccagcttattgaccaagttgtccaaacagctttatca
gagacacaggatccagaggaggtttctgtcactgtgaaagccttcatgactgcagacctt
ccaaatgaattaattgagttattggaaaaaattgtcttggataattctgtattcagtgaa
cacaggaatctccagaatttgctgatcctgactgccattaaggctgaccgcactcgtgta
atggaatacattaatcgactggataactatgatgctccagatattgcaaacattgccatc
agtaatgagctgtacgaagaagcctttgctatattcagaaaatttgatgttaatacttca
gcaattcaggtgctgattgagcacattgggaatttagaccgtgcttatgaatttgcagag
agatgtaatgagccagcagtatggagccagctagccagagcgcagctgcagaaaaacttg
gtaaaagaagccattgactcctatataaaggcagatgatccatctgcctacatggaagtt
gttcaagcagctaatagaaatgataactgggaggacctagtcaagttcttgcagatggcc
aggaagaaggctagagagtcttatgtagagacagaacttatttttgcctttgcaaaaact
aatcgtctctcagaactggaggaatttattagcggccctaataatgcccatatacagcag
gttggtgatcgttgttatgaagaggatatgtatgaagcagcaaaactactttataacaat
gtatctaactttgctcgcttggcatctaccttggtgcaccttggagagtatcaggcagca
gtggacagtggccgcaaagccaacagcacaaggacttggaaggaggtatgctttgcctgt
gtggatggaagagaattccgcttggcacagatatgtggcttgcacatagtcatccatgct
gatgaacttgaagagctgattagttactatcaggatcgtggctacttcgaagaactgatt
gcccttctggaagctgccttgggcctagagcgtgctcacatgggaatgtttactgaactc
gccatcttatactccaaatttaagccccagaaaatgagggaacatctggagctcttctgg
tctagagttaatattccaaaggtgctcagagctgcagaacaggctcatctctgggcagaa
cttgtattcctctatgacaaatacgaggagtatgacaatgcaataattactatgatgaat
catcctactgatgcctggaaggaaggacagtttaaagatataattgccaaggtggcgaat
gtggagctgtattacaaagccttgcaattctacttagactacaaacctctgctgatcaat
gatcttctgcttgtattatctccacgactggatcacaccaggacagtcaattttttctcg
aaggttaatcagctgcttctagtaaagccttatttgcgttcagtgcagaaccacaataat
aaaggagttaatgaagctctaaacaaccttttaacacaggaggaggactaccagggtttg
agagcttccattgatgcctatgacaactttgataacatagctttggctcagcgtctggaa
aagcatgagctcattgagtttaggcgtattgcagcatacttgtataagggtaacaaccgc
tggaagcagagcgtggagctatgcaagaaagaccatctgtataaggatgctatgcagtat
gctgcagagtccaaagatgtagaactagcagaaaagctgcttcagtggttcctggaagaa
ggcaagcaggagtgttttgcagcctgccttttcacatgttacgacttgctgcacccagat
gtagtcctcgagttggcatggaggcataatatcatggacttcgcaatgccttatttcgtc
caagtgatgagagagtacctcaccaaagtggataatcttgatgcttctgaaagcctaaga
aaagaagaggaacaagtaactgaacctactccaatagtatttggccagcagttgatgtta
acagcgggccccagtgcagtacctccccagacaaactttccatatggatacacagcacca
ggattcacccagccacctgtttatggtttcaatatgtaa

DBGET integrated database retrieval system