KEGG   Meleagris gallopavo (turkey): 100542345Help
Entry
100542345         CDS       T01523                                 

Gene name
APOA4
Definition
(RefSeq) apolipoprotein A4
  KO
K08760  apolipoprotein A-IV
Organism
mgp  Meleagris gallopavo (turkey)
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein YtxH Baculo_PEP_C ApoLp-III DUF883 DUF4795 Exonuc_VII_L Fzo_mitofusin Prominin DUF1664 AAA_13 Gp58 BshC DUF4854 ApoO DUF4407 DUF885 Tht1 Fib_alpha DUF4455 Phasin Gp-FAR-1 FUSC DUF4456
Motif
Other DBs
NCBI-GeneID: 100542345
NCBI-ProteinID: XP_003212771
Ensembl: ENSMGAG00000003136
Position
26
AA seq 367 aa AA seqDB search
MSPKAAAFLLVLLAVAGTRADVSPDQVATVLWKYFTELGSNAKETVDQLQQAEITKQLNT
LLQSNLQSMNSYAEELQRRLVPFATELQAQLVQDSQRLKEQIQRELAELQAKLAPYADEV
HQQIGTNIRELQAKLSPYADELRSQVDRGTGELRRALEPFATELRERLQDNAGSIQASLG
SYTERLQQQIDSSVEGLKEQLTPLADELKEQVAQSVEGLRKGLSPYAQEVQDGLNRQLES
LTMQMERAAEELRSRLAASSEEMRAQLSPLAQELQQALSADAEAVRQRLAPLAQQLDERL
AQTVEAFRQQAAPISETFRQQLVQRLEEMKQKLDSGTAGVEDHLDLLEKEVREKVATFLS
TTEQAES
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgaaagcagctgccttcctcctggtgctcctggctgtggcagggacacgggcc
gacgtcagccctgaccaggtggccactgtgctctggaagtacttcaccgagctgggcagc
aatgccaaggagaccgtggaccaactgcagcaagctgagatcaccaagcagctcaacacc
ctgctgcagagcaacctgcagagcatgaactcctatgctgaggagctgcagaggcgcctg
gtgccctttgccacggagctgcaggcacagctggtgcaggactcgcagcggctgaaggag
cagatccagcgcgagctggctgagctgcaggccaagctggctccctacgccgacgaggtg
caccagcagatcggcaccaacatccgtgagctgcaggccaagctgagcccctacgccgac
gagctgcgctcgcaggtggaccgcggcactggggagctgcggcgggcgctggagcctttt
gccaccgagctgcgggagcggctgcaggacaacgccggcagcatccaggcctctctgggc
tcctacaccgagcggctgcagcaacagatcgacagcagcgtggaggggctgaaggagcag
ctgacaccgctggccgacgagctgaaggagcaggtggcacagagcgtggaggggctgcgc
aaggggctcagcccttacgcccaggaggtgcaggacggcctcaaccggcagctggagagc
ctcacgatgcagatggagcgggcggccgaggagctgcgctcccgcctggctgccagctcg
gaggagatgcgtgcccagctcagcccgctggcccaggagctgcagcaggcgctgagtgca
gatgctgaggccgtgcggcagcggctggccccgctggcacagcagctggatgaacgcctg
gcgcagacggtggaggcgttccggcagcaagcagcacccatcagcgagaccttccggcag
cagctggtgcaacgcctggaggagatgaagcagaagctggactcgggcactgctggcgtg
gaggatcacctggaccttttggagaaggaggtgcgggagaaggtggccaccttcctcagt
accacagagcaggcggagagctga

DBGET integrated database retrieval system