KEGG   Meleagris gallopavo (turkey): 100542345Help
Entry
100542345         CDS       T01523                                 

Definition
apolipoprotein A-IV-like
Orthology
K08760  
apolipoprotein A-IV
Organism
mgp  Meleagris gallopavo (turkey)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
26
AA seq 367 aa AA seqDB search
MSPKAAAFLLVLLAVAGTRADVSPDQVATVLWKYFTELGSNAKETVDQLQQAEITKQLNT
LLQSNLQSMNSYAEELQRRLVPFATELQAQLVQDSQRLKEQIQRELAELQAXLAPYADEV
HQQIGTNIRELQAKLSPYADELRSQVDRGTGELRRALEPFATELRERLQDNAGSIQASLG
SYTERLQQQIDSSVEGLKEQLTPLADELKEQVAQSVEGLRKGLSPYAQEVQDGLNRQLES
LTMQMERAAEELRSRLAASSEEMRAQLSPLAQELQQALSADAEAVRQRLAPLAQQLDERL
AQTVEAFRQQAAPISETFRQQLVQRLEEMKQKLDSGTAGVEDHLDLLEKEVREKVATFLS
TTEQAES
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgaaagcagctgccttcctcctggtgctcctggctgtggcagggacacgggcc
gacgtcagccctgaccaggtggccactgtgctctggaagtacttcaccgagctgggcagc
aatgccaaggagaccgtggaccaactgcagcaagctgagatcaccaagcagctcaacacc
ctgctgcagagcaacctgcagagcatgaactcctatgctgaggagctgcagaggcgcctg
gtgccctttgccacggagctgcaggcacagctggtgcaggactcgcagcggctgaaggag
cagatccagcgcgagctggccgagctgcaggccnagctggctccctacgccgacgaggtg
caccagcagatcggcaccaacatccgtgagctgcaggccaagctgagcccctacgccgac
gagctgcgctcgcaggtggaccgcggcactggggagctgcggcgggcgctggagcctttt
gccaccgagctgcgggagcggctgcaggacaacgccggcagcatccaggcctctctgggc
tcctacaccgagcggctgcagcaacagatcgacagcagcgtggaggggctgaaggagcag
ctgacaccgctggccgacgagctgaaggagcaggtggcacagagcgtggaggggctgcgc
aaggggctcagcccttacgcccaggaggtgcaggacggcctcaaccggcagctggagagc
ctcacgatgcagatggagcgggcggccgaggagctgcgctcccgcctggctgccagctcg
gaggagatgcgtgcccagctcagcccgctggcccaggagctgcagcaggcgctgagtgca
gatgctgaggccgtgcggcagcggctggccccgctggcacagcagctggatgaacgcctg
gcgcagacggtggaggcgttccggcagcaagcagcacccatcagcgagaccttccggcag
cagctggtgcaacgcctggaggagatgaagcagaagctggactcgggcactgctggcgtg
gaggatcacctggaccttttggagaaggaggtgcgggagaaggtggccaccttcctcagt
accacagagcaggcggagagctga

DBGET integrated database retrieval system