KEGG   Meleagris gallopavo (turkey): 100542373Help
Entry
100542373         CDS       T01523                                 

Gene name
THBS1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
p53 signaling pathway
Phagosome
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    100542373 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100542373 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    100542373 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    100542373 (THBS1)
  Cellular commiunity
   04510 Focal adhesion
    100542373 (THBS1)
Heparan sulfate/heparin binding proteins [BR:mgp00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  100542373 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1180 aa AA seqDB search
MLAMGPAAGLVLLLLALGSPEAKRTAESRGDDDNVFDVFEHLNLNRNGAGRRAPGVHLVK
GPESSSPAYRIEDASRIPAVPDSKFQDLLDIIHAEKGFILLATLRQAKKSRGTLLSVERK
DGSGHVFSLVSNGKAGTLDLSLSGDGKQQLVSVEDALLATGHWKNITLFVQEDRAQLYVG
CEKMENAELDIPIQKIFSRGLASSARLRIAKGGVNDNFQGLLQNVRFVFGTTPETILRNK
GCSSSTSAIITLDNPINGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLRSMV
TTLQDRVRKVTEENELIAKVVQITPGVCIHNGILHKNKEEWTIDSCTECTCQNSATICRK
VSCPLMPCSNATVPDGECCPRCWPSDYADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLN
NRCEGSSVQTRTCHLQECDKRFKQDGGWSHWSPWSSCSVTCGTGMITRIRLCNSPVPQLN
GKPCEGEARETKPCQKDPCPINGNWGPWSPWDACTVTCGGGLQKRSRLCNNPEPQYGGKT
CVGEAKGTQVCNKQDCPVDGCLSNPCFAGTTCTSSPDGSWKCGACPAGYHGDGIHCQDID
ECKEVPDACFVFNGEHRCENTEPGYNCLPCPPRFTGSQPFGRSVEDAMANKQVCKPRNPC
TDGTHDCNKNAKCNYLGHFSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANAT
YHCKKDNCPNLPNSGQEDYDKDGIGDACDNDDDDDGISDDRDNCPFIYNPQQYDYDRDDV
GDRCDNCPYNHNPDQIDTDNNGEGDACAVDIDGDGVLNERDNCQYVYNVDQRDTDLDGVG
DQCDNCPLEHNPDQEDTDSDRIGDECDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGK
GDACDHDDDNDGIPDDKDNCRLVANPDQADSDGDGRGDACKDDFDQDSVPDIDDICPENV
EISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSG
TFFINTERDDDYAGFVFAYQSSSRFYVVMWKQITQSYWDSTPTKAQGYSGLSIKVVNSTT
GPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKK
IMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccatggggccagccgctggtctcgttctccttctcctggcgctcggcagcccg
gaagccaaacgcacggcagagtccaggggtgatgatgacaacgtctttgatgtctttgaa
caccttaacttgaatcgcaacggagctgggcgccgggcacctggggtgcatctggtgaag
gggccggagtcctccagccctgcttaccgcattgaagatgccagtcgtatccctgctgtc
cctgactccaagttccaagacttgttagatatcatccatgctgagaagggcttcatcctt
ctggccactctccggcaagccaagaagagcagaggcacactgctgtctgtggaacggaaa
gacggctctggtcatgtcttcagtctagtttcaaatggcaaggcaggcaccttggacctg
agcctctctggtgatggcaagcagcagttagtgtctgtagaggatgctttgttagctaca
ggacactggaagaacatcaccttgtttgtgcaagaagaccgggctcagctttatgtgggg
tgtgagaaaatggagaatgctgaactggacattcccattcaaaagattttcagcaggggc
ctggccagcagtgccaggcttcgtattgccaaagggggagtcaatgacaacttccaggga
ctgttgcagaacgtacggttcgtgtttggaacaactccggaaactattctgaggaacaaa
ggctgctccagctctactagtgcaatcattactttggacaaccccataaatggttccagc
ccagctatccgcaccaactacattggccataaaacaaaggacattcaagcagtctgtggc
ttttcctgtgatgaactaactaacatgtttgtagaactgcaagggctacggtccatggtt
acaacacttcaagacagagttcgcaaagtgactgaagaaaatgaactgattgccaaagtg
gtccagatcactcctggagtatgcattcataatgggatcttgcacaaaaataaggaagag
tggactattgacagctgcactgaatgtacttgccagaactctgccactatatgccggaaa
gtgtcttgccctctcatgccttgttccaatgccactgtgcctgatggggagtgctgcccc
cgatgctggcctagcgactatgcagatgatggatggtctccttggtctgaatggacttca
tgttcagtgacctgtgggaatggaattcagcagagagggcgttcctgtgacagcctcaac
aaccgctgtgaagggtcttctgtgcagactcggacttgccaccttcaagagtgtgataag
agatttaaacaagatggtggttggagccactggtcaccgtggtcatcatgttcagtcacc
tgtggtacaggcatgatcactagaattcgtctctgcaactctccagtaccacagctgaat
ggcaagccttgtgagggtgaagcaagagaaaccaagccctgccagaaagatccttgccca
attaacggcaactggggaccatggtctccatgggatgcttgcacagtgacatgtggagga
ggacttcagaaacgcagccgtctctgcaataatcccgagcctcaatatggtgggaagact
tgtgtaggtgaagctaaaggaactcaggtctgcaacaaacaggactgtccagttgatggg
tgtctgtctaatccctgctttgcgggaactacgtgtacaagctcccctgatggttcttgg
aagtgcggtgcctgtcctgctggctaccatggcgatggtatccactgccaagatattgat
gagtgcaaagaagttcctgatgcctgctttgtcttcaatggagaacacaggtgtgagaat
actgaacctggatacaactgtctgccttgtccaccacgtttcactgggtcacagccattt
ggtcgcagtgttgaggatgccatggcaaacaaacaggtctgcaagccacgtaatccatgc
acagatggaacacacgattgcaacaagaatgccaaatgcaattaccttggccacttcagt
gacccgatgtatcgttgtgaatgtaaaccaggctatgctggcaatggcataatctgtgga
gaagatactgacttggatggatggccaaatgagaaccttgtctgtgttgccaatgccact
taccactgtaaaaaagataactgccccaatctccccaactctgggcaggaagactatgat
aaagatgggattggtgatgcctgtgataatgatgatgacgatgatggtatttctgatgac
cgggacaactgcccattcatctacaacccacagcagtatgactatgacagggatgatgtt
ggtgaccgttgtgataactgcccctacaatcacaaccctgatcagattgacactgacaac
aatggagaaggagatgcatgtgcagtggatattgatggagatggggtcctcaatgaaagg
gacaactgccaatatgtctacaatgtagaccagagggacacagacttggacggtgttgga
gatcagtgtgataactgtccactggaacataatcctgaccaggaagatactgactctgac
cgtataggtgatgagtgtgacaacaaccaggacatagatgaagatggtcatcaaaataat
cttgataactgcccttatgtgcccaatgccaatcaagctgatcatgacaaggatggaaaa
ggtgatgcctgtgaccatgatgatgacaatgatggtattcctgatgacaaagataactgc
agattagttgccaacccggatcaagcggattctgatggtgatggacgtggagatgcttgc
aaagatgactttgaccaagacagtgtgccagacattgatgacatctgtcccgaaaatgtg
gaaatcagtgagactgacttccgaaggtttcaaatgattcccttggatccaaaaggaaca
tcccaaaatgatccaaactgggttgtacgtcaccagggtaaagaactggttcagacagtc
aactgtgaccctggccttgcagttggttttgatgaattcaatgctgtggacttcagtggc
accttctttatcaatacagaaagggatgatgattatgctggctttgtatttgcctaccaa
tctagcagtcgtttttacgttgtcatgtggaagcagattactcagtcttactgggactcc
acaccaaccaaagctcaaggctactcaggtctctccatcaaggttgtgaattccaccaca
ggtccaggagaacaccttcgtaatgctctgtggcacacaggaaacacacctggccaggtg
agaactttgtggcatgaccctcgtcacataggctggaaagacttcactgcatacagatgg
cgccttagccatagaccaaagactggctacatcagagttgtaatgtatgaagggaagaaa
atcatggcagactcaggaccaatctatgataaaacttatgctggtggtcgtctaggatta
tttgttttctctcaagaaatggtgttcttctcagatcttaaatatgaatgcagagatcca
taa

DBGET integrated database retrieval system