KEGG   Meleagris gallopavo (turkey): 100542429Help
Entry
100542429         CDS       T01523                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100542429
Enzymes [BR:mgp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     100542429
Glycosyltransferases [BR:mgp01003]
 Glycan extension
  Type 3 chain
   100542429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 366 aa AA seqDB search
MASSKSLMNLLTFSFGSAIGFFLCYLLFSMILEEQVEIQPRILHNDPHGQHSEDTDNNQL
QGQMNFNADSGQHRDENKNVADGLYQKVKILCWVMTGPQNLEKKARHVKATWAQRCNKIL
FMSSEENKDFPTVGLETKEGRDQLYWKTIKAFQYVYDHYFDDADWFMKADDDTYVILDNL
RWLLSKYSPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVTAFKTNKCSHSSSIE
DLALGKCMEIINVQAGDSRDTSGRETFHPFVPEHLLIRGYLPKTFWYWNYNYYPAVEGPG
CCSDLAVSFHYVDSMTMYYLEYLVYHLRPYGYSYRYNPDLAKSLEEQNKNEALEDNPKLK
QKSSEN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttctaagtctttgatgaaccttctgaccttcagttttggatctgcgatagga
ttttttctatgctatctcctgtttagcatgatactagaagaacaggttgagatccaacct
cgtattcttcacaatgatccacatggtcaacactcagaagatactgataacaatcagctg
caaggacaaatgaatttcaatgcggactctggacagcatagagatgagaataaaaacgtt
gcagatggactctatcagaaggtgaaaatactttgttgggtcatgactggacctcaaaat
ctagagaagaaagccagacatgttaaagccacctgggcccaacgttgcaataaaatactt
tttatgagctctgaggaaaataaagacttcccaacagtgggcctagaaaccaaagaaggc
agggaccaactttactggaagactataaaagcttttcagtatgtttatgaccattatttt
gatgatgctgattggttcatgaaagcagatgatgatacgtatgttatattggacaattta
agatggcttctttcaaaatacagtcctgaacagccaatatactttggaagaaggtttaag
ccttatgtgaaacagggctacatgagtggaggagcggggtatgttctgagcaaagaagct
ctgaaaagatttgttactgcttttaaaaccaacaaatgctctcatagttcctctattgaa
gacttagcactaggaaagtgcatggagatcattaatgtacaagcaggagattccagggat
acaagtggtagggaaacctttcatccctttgttccagaacatctcttaatcagaggatac
ctaccaaaaacattctggtactggaattacaattattaccctgctgtagagggccctgga
tgctgctccgaccttgcggtttcatttcactatgttgattccatgactatgtattacttg
gagtacttggtttaccatctccgtccatatgggtattcgtatcggtacaaccctgatttg
gcaaagagcctggaggagcagaacaaaaatgaagcactggaggataatccaaagctaaag
caaaaatcttctgagaattaa

DBGET integrated database retrieval system