KEGG   Meleagris gallopavo (turkey): 100542540Help
Entry
100542540         CDS       T01523                                 

Gene name
XIAP
Definition
(RefSeq) X-linked inhibitor of apoptosis
  KO
K04725  
E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Necroptosis
Focal adhesion
NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100542540 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100542540 (XIAP)
   04217 Necroptosis
    100542540 (XIAP)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100542540 (XIAP)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    100542540 (XIAP)
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100542540 (XIAP)
Ubiquitin system [BR:mgp04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100542540 (XIAP)
Mitochondrial biogenesis [BR:mgp03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100542540 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
9
AA seq 598 aa AA seqDB search
MPRAAEGCSGHLGERGCCVLAQTHSRQLRSCYKHRGSQVHQSFTLRHHNVIQLRNTAPFL
ELGTPSLDVHSWGKGPLCQKGYECFSLMIPTRNKLGNLKEAPYEEMTCNGPDSSEPGATP
ATDGNQEWTQEHDRLGTFVEFPPDCPVPASALARAGFVYTGEGDKVKCFSCHATVEGWQP
GDSAVDRHKNLSPDCRFISESAFLENNVHPLVQSHRHRTENGSNSLALSTALEDLSDVEA
DYLLRTRQVVDMSDTLYPKNPAMCSEEARLKSFHNWPPYGLLTPKELASAGLYYTGVGDQ
VACFCCGGKLKNWEPGDRAWSEHKRHFPKCFFVLGRDVGNVSSESICAELGRSCLNNEQH
PRNPSMVEYERRIQTFLTWIYPVNKEHLAEAGFYSTGNGDHVVCFHCGGGLQEWKENEDP
WDQHAKWFPGCKFLREEKGLEFINNVHLRDGCRDSTMEAAEVTILPKDDLLQNQLVQNAI
HMGFSLSEIRSIMEKKLHMSGESYTSVEDLVADLISAQKENVKGEPPKESPLEQDLSIEE
KLRRLQEEKLCKICMAKDISVVLIPCGHLVACKECAEAVNKCPLCCTNIIKRQKIFMY
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgccacgagcagcagaaggctgtagtggccacctgggtgagagaggctgctgtgtgctg
gctcaaactcattccagacagctgaggagctgctataaacacaggggaagccaggtgcat
caaagctttactctcaggcaccacaatgtcattcagctgaggaacacagcaccctttctt
gaacttggcaccccgagcttggatgtgcactcctggggaaagggccctctgtgccaaaag
ggctatgagtgcttttcattaatgattcctacccgtaacaagttagggaatctgaaggaa
gcaccctacgaagagatgacgtgtaatggcccagatagctccgaacctggtgccactcca
gccactgatggcaaccaggagtggacccaggaacacgaccgactaggaacctttgtggag
tttccccctgattgtccagttccagcatcagcacttgctcgagctggctttgtttatact
ggagaaggtgataaagtcaagtgcttcagttgccacgcgactgttgaaggatggcagcct
ggggattctgcagttgacagacacaaaaacctttccccagattgcagatttatttctgag
tctgcttttttggaaaataatgtacatcctcttgtgcagagccaccggcatagaactgaa
aatggctccaacagtttagccctctcaactgctctggaggacttgtctgatgtggaggca
gattacctgttgagaaccaggcaggttgtggacatgtctgatactctgtatcctaaaaac
cccgctatgtgcagtgaagaagccaggctgaagtcctttcacaactggcctccctatggc
ctattgactccaaaggaattagctagtgcaggactctactatacaggtgttggtgatcag
gtcgcgtgtttttgttgtggtgggaaactgaaaaactgggagcctggtgatcgagcttgg
tctgagcacaagaggcatttccccaaatgcttttttgtcctgggtcgggacgttggaaat
gtttcaagtgaatctatttgtgctgagcttgggagaagctgtctaaacaacgagcagcat
ccaaggaatccatccatggtagaatatgaaaggaggatacaaacatttctcacttggata
taccctgttaacaaggaacatcttgctgaagcagggttctacagcacaggtaatggcgat
cacgttgtgtgcttccactgcggtggaggattgcaagagtggaaggaaaatgaagacccg
tgggatcaacacgccaagtggtttcctgggtgcaagttcttgagagaggaaaagggacta
gaatttataaataatgttcacttaagagatggatgtagggattcaacaatggaagctgct
gaagttacaatacttcctaaagatgacctcttacagaatcagttggtacagaatgccatt
cacatgggtttcagtttgtctgagattaggagcattatggaaaagaagttgcacatgtct
ggagaaagctatacatctgttgaggatctggtagcagacttaataagtgctcagaaagaa
aatgtaaagggagaaccaccaaaagaaagcccacttgagcaagatctcagtattgaagag
aagttaagacgcttacaagaagaaaagctctgtaaaatctgtatggctaaagacatatca
gtagtcctcattccctgtggtcacctggttgcttgtaaggaatgtgctgaagcagttaat
aaatgtcctctgtgttgtacaaatattatcaaaagacagaaaatttttatgtattaa

DBGET integrated database retrieval system