KEGG   Meleagris gallopavo (turkey): 100542540Help
Entry
100542540         CDS       T01523                                 

Definition
baculoviral IAP repeat-containing protein 4-like
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100542540
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100542540
  Cellular commiunity
   04510 Focal adhesion
    100542540
Mitochondrial biogenesis [BR:mgp03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100542540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 493 aa AA seqDB search
MTCNGPDSSEPGATPATDGNQEWTQEHDRLGTFVEFPPDCPVPASALARAGFVYTGEGDK
VKCFSCHATVEGWQPGDSAVDRHKNLSPDCRFISESAFLENNVHPLVQSHRHRTENGSNS
LALSTALEDLSDVEADYLLRTRQVVDMSDTLYPKNPAMCSEEARLKSFHNWPPYGLLTPK
ELASAGLYYTGVGDQVACFCCGGKLKNWEPGDRAWSEHKRHFPKCFFVLGRDVGNVSSES
ICAELGRSCLNNEQHPRNPSMVEYERRIQTFLTWIYPVNKEHLAEAGFYSTGNGDHVVCF
HCGGGLQEWKENEDPWDQHAKWFPGCKFLREEKGLEFINNVHLRDGCRDSTMEAAEVTIL
PKDDLLQNQLVQNAIHMGFSLSEIRSIMEKKLHMSGESYTSVEDLVADLISAQKENVKGE
PPKESPLEQDLSIEEKLRRLQEEKLCKICMAKDISVVLIPCGHLVACKECAEAVNKCPLC
CTNIIKRQKIFMY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacgtgtaatggcccagatagctccgaacctggtgccactccagccactgatggcaac
caggagtggacccaggaacacgaccgactaggaacctttgtggagtttccccctgattgt
ccagttccagcatcagcacttgctcgagctggctttgtttatactggagaaggtgataaa
gtcaagtgcttcagttgccacgcgactgttgaaggatggcagcctggggattctgcagtt
gacagacacaaaaacctttccccagattgcagatttatttctgagtctgcttttttggaa
aataatgtacatcctcttgtgcagagccaccggcatagaactgaaaatggctccaacagt
ttagccctctcaactgctctggaggacttgtctgatgtggaggcagattacctgttgaga
accaggcaggttgtggacatgtctgatactctgtatcctaaaaaccccgctatgtgcagt
gaagaagccaggctgaagtcctttcacaactggcctccctatggcctattgactccaaag
gaattagctagtgcaggactctactatacaggtgttggtgatcaggtcgcgtgtttttgt
tgtggtgggaaactgaaaaactgggagcctggtgatcgagcttggtctgagcacaagagg
catttccccaaatgcttttttgtcctgggtcgggacgttggaaatgtttcaagtgaatct
atttgtgctgagcttgggagaagctgtctaaacaacgagcagcatccaaggaatccatcc
atggtagaatatgaaaggaggatacaaacatttctcacttggatataccctgttaacaag
gaacatcttgctgaagcagggttctacagcacaggtaatggcgatcacgttgtgtgcttc
cactgcggtggaggattgcaagagtggaaggaaaatgaagacccgtgggatcaacacgcc
aagtggtttcctgggtgcaagttcttgagagaggaaaagggactagaatttataaataat
gttcacttaagagatggatgtagggattcaacaatggaagctgctgaagttacaatactt
cctaaagatgacctcttacagaatcagttggtacagaatgccattcacatgggtttcagt
ttgtctgagattaggagcattatggaaaagaagttgcacatgtctggagaaagctataca
tctgttgaggatctggtagcagacttaataagtgctcagaaagaaaatgtaaagggagaa
ccaccaaaagaaagcccacttgagcaagatctcagtattgaagagaagttaagacgctta
caagaagaaaagctctgtaaaatctgtatggctaaagacatatcagtagtcctcattccc
tgtggtcacctggttgcttgtaaggaatgtgctgaagcagttaataaatgtcctctgtgt
tgtacaaatattatcaaaagacagaaaatttttatgtattaa

DBGET integrated database retrieval system