KEGG   Meleagris gallopavo (turkey): 100542540Help
Entry
100542540         CDS       T01523                                 

Definition
baculoviral IAP repeat-containing protein 4-like
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:mgp04120]
Cellular Processes; Cell growth and death; Apoptosis [PATH:mgp04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:mgp04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 493 aa AA seqDB search
MTCNGPDSSEPGATPATDGNQEWTQEHDRLGTFVEFPPDCPVPASALARAGFVYTGEGDK
VKCFSCHATVEGWQPGDSAVDRHKNLSPDCRFISESAFLENNVHPLVQSHRHRTENGSNS
LALSTALEDLSDVEADYLLRTRQVVDMSDTLYPKNPAMCSEEARLKSFHNWPPYGLLTPK
ELASAGLYYTGVGDQVACFCCGGKLKNWEPGDRAWSEHKRHFPKCFFVLGRDVGNVSSES
ICAELGRSCLNNEQHPRNPSMVEYERRIQTFLTWIYPVNKEHLAEAGFYSTGNGDHVVCF
HCGGGLQEWKENEDPWDQHAKWFPGCKFLREEKGLEFINNVHLRDGCRDSTMEAAEVTIL
PKDDLLQNQLVQNAIHMGFSLSEIRSIMEKKLHMSGESYTSVEDLVADLISAQKENVKGE
PPKESPLEQDLSIEEKLRRLQEEKLCKICMAKDISVVLIPCGHLVACKECAEAVNKCPLC
CTNIIKRQKIFMY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacgtgtaatggcccagatagctccgaacctggtgccactccagccactgatggcaac
caggagtggacccaggaacacgaccgactaggaacctttgtggagtttccccctgattgt
ccagttccagcatcagcacttgctcgagctggctttgtttatactggagaaggtgataaa
gtcaagtgcttcagttgccacgcgactgttgaaggatggcagcctggggattctgcagtt
gacagacacaaaaacctttccccagattgcagatttatttctgagtctgcttttttggaa
aataatgtacatcctcttgtgcagagccaccggcatagaactgaaaatggctccaacagt
ttagccctctcaactgctctggaggacttgtctgatgtggaggcagattacctgttgaga
accaggcaggttgtggacatgtctgatactctgtatcctaaaaaccccgctatgtgcagt
gaagaagccaggctgaagtcctttcacaactggcctccctatggcctattgactccaaag
gaattagctagtgcaggactctactatacaggtgttggtgatcaggtcgcgtgtttttgt
tgtggtgggaaactgaaaaactgggagcctggtgatcgagcttggtctgagcacaagagg
catttccccaaatgcttttttgtcctgggtcgggacgttggaaatgtttcaagtgaatct
atttgtgctgagcttgggagaagctgtctaaacaacgagcagcatccaaggaatccatcc
atggtagaatatgaaaggaggatacaaacatttctcacttggatataccctgttaacaag
gaacatcttgctgaagcagggttctacagcacaggtaatggcgatcacgttgtgtgcttc
cactgcggtggaggattgcaagagtggaaggaaaatgaagacccgtgggatcaacacgcc
aagtggtttcctgggtgcaagttcttgagagaggaaaagggactagaatttataaataat
gttcacttaagagatggatgtagggattcaacaatggaagctgctgaagttacaatactt
cctaaagatgacctcttacagaatcagttggtacagaatgccattcacatgggtttcagt
ttgtctgagattaggagcattatggaaaagaagttgcacatgtctggagaaagctataca
tctgttgaggatctggtagcagacttaataagtgctcagaaagaaaatgtaaagggagaa
ccaccaaaagaaagcccacttgagcaagatctcagtattgaagagaagttaagacgctta
caagaagaaaagctctgtaaaatctgtatggctaaagacatatcagtagtcctcattccc
tgtggtcacctggttgcttgtaaggaatgtgctgaagcagttaataaatgtcctctgtgt
tgtacaaatattatcaaaagacagaaaatttttatgtattaa

DBGET integrated database retrieval system