KEGG   Meleagris gallopavo (turkey): 100542540Help
Entry
100542540         CDS       T01523                                 

Gene name
XIAP
Definition
X-linked inhibitor of apoptosis, E3 ubiquitin protein ligase
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100542540 (XIAP)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100542540 (XIAP)
  Cellular commiunity
   04510 Focal adhesion
    100542540 (XIAP)
Mitochondrial biogenesis [BR:mgp03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100542540 (XIAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 598 aa AA seqDB search
MPRAAEGCSGHLGERGCCVLAQTHSRQLRSCYKHRGSQVHQSFTLRHHNVIQLRNTAPFL
ELGTPSLDVHSWGKGPLCQKGYECFSLMIPTRNKLGNLKEAPYEEMTCNGPDSSEPGATP
ATDGNQEWTQEHDRLGTFVEFPPDCPVPASALARAGFVYTGEGDKVKCFSCHATVEGWQP
GDSAVDRHKNLSPDCRFISESAFLENNVHPLVQSHRHRTENGSNSLALSTALEDLSDVEA
DYLLRTRQVVDMSDTLYPKNPAMCSEEARLKSFHNWPPYGLLTPKELASAGLYYTGVGDQ
VACFCCGGKLKNWEPGDRAWSEHKRHFPKCFFVLGRDVGNVSSESICAELGRSCLNNEQH
PRNPSMVEYERRIQTFLTWIYPVNKEHLAEAGFYSTGNGDHVVCFHCGGGLQEWKENEDP
WDQHAKWFPGCKFLREEKGLEFINNVHLRDGCRDSTMEAAEVTILPKDDLLQNQLVQNAI
HMGFSLSEIRSIMEKKLHMSGESYTSVEDLVADLISAQKENVKGEPPKESPLEQDLSIEE
KLRRLQEEKLCKICMAKDISVVLIPCGHLVACKECAEAVNKCPLCCTNIIKRQKIFMY
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgccacgagcagcagaaggctgtagtggccacctgggtgagagaggctgctgtgtgctg
gctcaaactcattccagacagctgaggagctgctataaacacaggggaagccaggtgcat
caaagctttactctcaggcaccacaatgtcattcagctgaggaacacagcaccctttctt
gaacttggcaccccgagcttggatgtgcactcctggggaaagggccctctgtgccaaaag
ggctatgagtgcttttcattaatgattcctacccgtaacaagttagggaatctgaaggaa
gcaccctacgaagagatgacgtgtaatggcccagatagctccgaacctggtgccactcca
gccactgatggcaaccaggagtggacccaggaacacgaccgactaggaacctttgtggag
tttccccctgattgtccagttccagcatcagcacttgctcgagctggctttgtttatact
ggagaaggtgataaagtcaagtgcttcagttgccacgcgactgttgaaggatggcagcct
ggggattctgcagttgacagacacaaaaacctttccccagattgcagatttatttctgag
tctgcttttttggaaaataatgtacatcctcttgtgcagagccaccggcatagaactgaa
aatggctccaacagtttagccctctcaactgctctggaggacttgtctgatgtggaggca
gattacctgttgagaaccaggcaggttgtggacatgtctgatactctgtatcctaaaaac
cccgctatgtgcagtgaagaagccaggctgaagtcctttcacaactggcctccctatggc
ctattgactccaaaggaattagctagtgcaggactctactatacaggtgttggtgatcag
gtcgcgtgtttttgttgtggtgggaaactgaaaaactgggagcctggtgatcgagcttgg
tctgagcacaagaggcatttccccaaatgcttttttgtcctgggtcgggacgttggaaat
gtttcaagtgaatctatttgtgctgagcttgggagaagctgtctaaacaacgagcagcat
ccaaggaatccatccatggtagaatatgaaaggaggatacaaacatttctcacttggata
taccctgttaacaaggaacatcttgctgaagcagggttctacagcacaggtaatggcgat
cacgttgtgtgcttccactgcggtggaggattgcaagagtggaaggaaaatgaagacccg
tgggatcaacacgccaagtggtttcctgggtgcaagttcttgagagaggaaaagggacta
gaatttataaataatgttcacttaagagatggatgtagggattcaacaatggaagctgct
gaagttacaatacttcctaaagatgacctcttacagaatcagttggtacagaatgccatt
cacatgggtttcagtttgtctgagattaggagcattatggaaaagaagttgcacatgtct
ggagaaagctatacatctgttgaggatctggtagcagacttaataagtgctcagaaagaa
aatgtaaagggagaaccaccaaaagaaagcccacttgagcaagatctcagtattgaagag
aagttaagacgcttacaagaagaaaagctctgtaaaatctgtatggctaaagacatatca
gtagtcctcattccctgtggtcacctggttgcttgtaaggaatgtgctgaagcagttaat
aaatgtcctctgtgttgtacaaatattatcaaaagacagaaaatttttatgtattaa

DBGET integrated database retrieval system