KEGG   Meleagris gallopavo (turkey): 100542624Help
Entry
100542624         CDS       T01523                                 

Definition
son of sevenless homolog 1-like
Orthology
K03099  
son of sevenless
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100542624
   04012 ErbB signaling pathway
    100542624
   04630 Jak-STAT signaling pathway
    100542624
   04068 FoxO signaling pathway
    100542624
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100542624
  Cellular commiunity
   04510 Focal adhesion
    100542624
   04540 Gap junction
    100542624
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100542624
   04912 GnRH signaling pathway
    100542624
  Development
   04320 Dorso-ventral axis formation
    100542624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1377 aa AA seqDB search
MLELTGADGRCEEERRNGEPFSVLLQPGPGSAGREGRRCLTLLPGLALDCQRSASWLHGS
VFVWLCVSTAMNGSCWVQVQVHPKLSSTEDALQYVEELILQLLNMLCQAQPRSFLDVEDR
VQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAV
LEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDLSALTLSDEEP
STSGEQTYYDLVKSFMAEVRQYIRELNLIIRVFREPYASNSKLFSSHDVENIFSRISDIH
ELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDMAEELAFDPYESYAQDILRPGFHDHFLS
QLSKPGAAFYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDEEDKECL
KQAITALLNLQSSMERICSKSLAKRRLSESACRFYTQQMKGKQLAIKKMNEIQKNIDGWE
GKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEK
FFMRKVQINDKDDTNEYRHAFEIILKDENSVIFAAKSAEEKNNWMAALISLQYRSTLERM
LDVTMLQEEKEEQMRFPNPELYRFAEPDSEENIVFEENMQPKSGIPIIKAGTVVKLIERL
TYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADRIAMENGDQPLSAE
LKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRLEEFIGTVRGKAMKKWVESI
TKIINRKKQAQAIGPSHNITFESPPPAIEWHISKPGHTETFDLLTLHPIEIARQLTLLES
DFYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVIVVS
RIIEILQVFQELNNFNGVLEIVSAMNSAAVYRLDHTFEQIPSRQKKILEEAYELSEDHYK
KYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEFLKRHGKELINFSKRRKVAEITGEIQQ
YQNQPYCLRVEFDIRRFFENLNPMGSSMETEFTDYLFNKSLEIEPRNVKPPPRFPKKYNY
PLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETETTASAPNSPRTPLTPPPAS
ATSSTTDACSVFDSDPSSPFHASRXSFFALCSLGSASVSSISFTKTSDEAHVPPPVPPRR
RPESAPAESSPSKITSAHLDSPPAIPPRQPTSKVYSPRYSVPDRTCISDPPESPPVLPPR
EPVRTPDVFSSSPLHLQPPPLGRKSELGNTFFPNSPSPFTPPPPQTPSPHVARRHLPSPP
LIQQDVDLHSVAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLQNAHSS
NT seq 4134 nt NT seq  +upstreamnt  +downstreamnt
atgttggagctgacgggcgcggacggacgctgtgaggaagagaggaggaacggtgagccc
ttctccgtcctcctgcagccgggcccgggaagtgcaggacgtgagggacggcggtgtctg
acgctgctgcccggactggccttggattgccagcggagcgcttcttggttgcacggcagt
gttttcgtgtggctgtgtgtatccacggcaatgaacggcagctgctgggttcaggtgcaa
gtccatcctaagctctcctctaccgaagatgcgttgcagtacgtggaggagctaattctc
cagttgctaaatatgttgtgtcaagcccagccgagaagttttctggatgtagaggatcgt
gttcagaaaagctttccccatcctattgataagtgggcaatagctgatgcccagtctgcc
attgagaaacgaaaacgaagaaatccgttatctctcccagtagaaaaaatccatccttta
ttgaaggaggttctaggttacaaaattgaccaccaagtgtctgtttacatagtggcagta
ttagaatacatttctgcagacatactaaaattggttgggaattatgtacgaaatataagg
cattatgagattacgaaacaagatattaaagtggcaatgtgtgctgataaggtgttaatg
gatatgttccatcaagatgtagaagatttaagtgcactaactttatctgatgaagagcct
tccacttcaggggagcaaacctattatgacctggtgaagtcattcatggcagaggttcgg
caatatataagggaacttaatctcattatcagagtctttagagagccatatgcctccaac
tccaaactattttcatctcatgatgttgaaaatatatttagtcgtatatcggacattcac
gaacttagtgtaaagttgttgggtcatatagaagacactgttgaaatgacagatgaaggt
agtcctcatccgttagtaggcagctgttttgaagatatggctgaggaactagcatttgat
ccttacgaatcgtatgcacaagatattttacgacctggttttcatgatcattttctaagt
caattatcgaagccaggagcagcattttatttacagtcaataggtgaaggctttaaagaa
gctgttcagtatgttctcccccggctcctccttgcccctgtttaccactgccttcattat
tttgaactactaaaacaactagaagaaaaaagtgaggatgaagaggataaggagtgcttg
aagcaagcaataacagcccttctgaatcttcaaagcagtatggaacggatatgctccaaa
agtcttgcaaaacgaaggcttagtgaatctgcgtgccgattctatactcagcagatgaag
gggaaacagctggcaattaagaaaatgaatgaaatccagaaaaatatcgatggctgggag
ggtaaggacatcggacaatgctgtaatgagttcatcatggaagggacgctcacgcgcgtt
ggagcaaaacatgagagacacatatttctatttgatggcttgatgatttgctgtaagtca
aatcatggccagccaaggcttcctggtgctagcaatgcagaatatcgtctaaaagaaaag
ttcttcatgcgaaaggtacaaatcaatgataaagacgacactaatgagtacagacatgct
tttgaaatcatcttaaaagatgagaacagtgttatttttgctgctaaatcagctgaagag
aaaaataactggatggcagcattgatatctttgcaatatagaagcacgctggaaaggatg
ttggacgtaacgatgctgcaagaagaaaaagaggagcagatgagatttccaaatcctgag
ctttacaggtttgcagaacctgactcagaggagaatattgtgtttgaagaaaacatgcaa
cccaaatctggaatccccatcatcaaagcaggaactgttgtcaaacttattgagaggctg
acttaccacatgtatgcagatcccaactttgttcggacttttctcacaacatacagatcc
ttctgtaaaccccaggagttgttgagtctgctaatagaaagatttgaaattccagaacct
gagccaacagaagctgatcgtattgctatggagaatggagaccaacctcttagtgctgag
ctaaaaagatttagaaaggagtacattcaacctgtgcagctacgagtattaaacgtatgt
cgacactgggtagagcaccacttctatgactttgaaagagatgctgatcttctgcaacgt
ttggaggaattcattggaacagtacgaggcaaagcaatgaagaaatgggttgaatcgatc
acaaagataatcaaccggaagaagcaggcacaagccattgggccaagtcacaacattact
tttgaaagcccacctccagcgattgaatggcacataagcaaaccaggacacacagagact
tttgacttgctcactttgcatccaatagaaattgctcggcagctcactttacttgagtca
gatttttacagagctgtgcagccatctgaactagttggaagtgtgtggacgaaggaagat
aaagaaattaattctcccaatcttctcaaaatgataaggcatacaactaatcttactttg
tggtttgaaaaatgcattgtagaaacagaaaacctagaggaaagagtaattgtagtgagc
cgaataattgaaatcctgcaagtttttcaagagctaaacaacttcaatggcgtccttgag
attgtcagtgccatgaactctgcagcagtgtataggttggatcacacatttgagcaaatt
cccagtcgtcagaagaagattttagaagaagcttacgaactgagtgaggatcactataag
aaatacttggcaaaactcaggtccattaatcctccttgtgtgcctttttttggaatttac
ttaactaacattttaaagacagaagaaggcaatcctgaatttctaaagcggcatggaaaa
gaactcataaatttcagcaagagaagaaaagtagctgaaataactggagagatacagcag
taccagaaccagccatattgtttaagagtagaatttgacattaggagattttttgaaaac
ctgaatccgatgggaagcagcatggagacagaatttacagattatctgttcaacaagtcg
ctagagatagagccgagaaatgtgaagcctccaccaagatttcccaaaaagtacaactat
cctctcaagtccccaggtgttcggccatctaatccaaggccaggtaccatgagacaccct
acacccctgcaacaggaaccaagaaaaattagttacagccgcatcccagagagtgagaca
gaaactacagcatctgcaccaaactctccacgaacgcctttgaccccgccccctgcttct
gctacttcaagtactacggatgcctgcagtgtatttgactcagatccttcaagtcctttt
catgcaagtaggtgaagtttttttgctctgtgttcactaggatctgcttctgtgtcatcc
ataagctttaccaaaacttcagatgaagctcacgttcccccaccagttcctccacgaaga
agaccagaatctgccccagctgaatcctccccatcaaaaattacttctgcgcacctggac
agcccgccagcaatccctcctaggcaaccaacctctaaagtgtattcaccaaggtactcg
gtgcctgaccggacctgcatctctgacccccctgaaagccctcctgtgttaccaccacga
gaacctgtgcgaactccagatgttttctctagctcaccactacacctccagcctccacca
ctggggagaaaaagcgaacttggtaacacctttttcccaaacagtccctctccatttact
ccccctccccctcagacaccttctccacatgtagcacggaggcatcttccatcaccacca
ttgatacaacaagatgtggacctccattctgtcgctggaccacctgttcctccacgacaa
agcacttctcaacatatcccaaagcttcctccaaaaacttacaaaagggagcacacacac
ccatcgatgcatcgagacggaccgcccttgcttcagaatgcccactcctcctga

DBGET integrated database retrieval system