KEGG   Meleagris gallopavo (turkey): 100542624Help
Entry
100542624         CDS       T01523                                 

Gene name
SOS1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  
son of sevenless
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
mTOR signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100542624 (SOS1)
   04012 ErbB signaling pathway
    100542624 (SOS1)
   04068 FoxO signaling pathway
    100542624 (SOS1)
   04150 mTOR signaling pathway
    100542624 (SOS1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100542624 (SOS1)
   04540 Gap junction
    100542624 (SOS1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100542624 (SOS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100542624 (SOS1)
   04912 GnRH signaling pathway
    100542624 (SOS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
2
AA seq 637 aa AA seqDB search
MLYFYRVLNVCRHWVEHHFYDFERDADLLQRLEEFIGTVRGKAMKKWVESITKIINRKKQ
AQAIGPSHNITFESPPPAIEWHISKPGHTETFDLLTLHPIEIARQLTLLESDFYRAVQPS
ELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVIVVSRIIEILQVF
QELNNFNGVLEIVSAMNSAAVYRLDHTFEQIPSRQKKILEEAYELSEDHYKKYLAKLRSI
NPPCVPFFGIYLTNILKTEEGNPEFLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLR
VEFDIRRFFENLNPMGSSMETEFTDYLFNKSLEIEPRNVKPPPRFPKKYNYPLKSPGVRP
SNPRPGTMRHPTPLQQEPRKISYSRIPESETETTASAPNSPRTPLTPPPASATSSTTDAC
SVFDSDPSSPFHARSASVSSISFTKTSDEAHVPPPVPPRRRPESAPAESSPSKITSAHLD
SPPAIPPRQPTSKVYSPRYSVPDRTCISDPPESPPVLPPREPVRTPDVFSSSPLHLQPPP
LGRKSELGNTFFPNSPSPFTPPPPQTPSPHVARRHLPSPPLIQQDVDLHSVAGPPVPPRQ
STSQHIPKLPPKTYKREHTHPSMHRDGPPLLQNAHSS
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgctttatttttacagagtattaaacgtatgtcgacactgggtagagcaccacttctat
gactttgaaagagatgctgatcttctgcaacgtttggaggaattcattggaacagtacga
ggcaaagcaatgaagaaatgggttgaatcgatcacaaagataatcaaccggaagaagcag
gcacaagccattgggccaagtcacaacattacttttgaaagcccacctccagcgattgaa
tggcacataagcaaaccaggacacacagagacttttgacttgctcactttgcatccaata
gaaattgctcggcagctcactttacttgagtcagatttttacagagctgtgcagccatct
gaactagttggaagtgtgtggacgaaggaagataaagaaattaattctcccaatcttctc
aaaatgataaggcatacaactaatcttactttgtggtttgaaaaatgcattgtagaaaca
gaaaacctagaggaaagagtaattgtagtgagccgaataattgaaatcctgcaagttttt
caagagctaaacaacttcaatggcgtccttgagattgtcagtgccatgaactctgcagca
gtgtataggttggatcacacatttgagcaaattcccagtcgtcagaagaagattttagaa
gaagcttacgaactgagtgaggatcactataagaaatacttggcaaaactcaggtccatt
aatcctccttgtgtgcctttttttggaatttacttaactaacattttaaagacagaagaa
ggcaatcctgaatttctaaagcggcatggaaaagaactcataaatttcagcaagagaaga
aaagtagctgaaataactggagagatacagcagtaccagaaccagccatattgtttaaga
gtagaatttgacattaggagattttttgaaaacctgaatccgatgggaagcagcatggag
acagaatttacagattatctgttcaacaagtcgctagagatagagccgagaaatgtgaag
cctccaccaagatttcccaaaaagtacaactatcctctcaagtccccaggtgttcggcca
tctaatccaaggccaggtaccatgagacaccctacacccctgcaacaggaaccaagaaaa
attagttacagccgcatcccagagagtgagacagaaactacagcatctgcaccaaactct
ccacgaacgcctttgaccccgccccctgcttctgctacttcaagtactacggatgcctgc
agtgtatttgactcagatccttcaagtccttttcatgcaagatctgcttctgtgtcatcc
ataagctttaccaaaacttcagatgaagctcacgttcccccaccagttcctccacgaaga
agaccagaatctgccccagctgaatcctccccatcaaaaattacttctgcgcacctggac
agcccgccagcaatccctcctaggcaaccaacctctaaagtgtattcaccaaggtactcg
gtgcctgaccggacctgcatctctgacccccctgaaagccctcctgtgttaccaccacga
gaacctgtgcgaactccagatgttttctctagctcaccactacacctccagcctccacca
ctggggagaaaaagcgaacttggtaacacctttttcccaaacagtccctctccatttact
ccccctccccctcagacaccttctccacatgtagcacggaggcatcttccatcaccacca
ttgatacaacaagatgtggacctccattctgtcgctggaccacctgttcctccacgacaa
agcacttctcaacatatcccaaagcttcctccaaaaacttacaaaagggagcacacacac
ccatcgatgcatcgagacggaccgcccttgcttcagaatgcccactcctcctga

DBGET integrated database retrieval system