KEGG   Meleagris gallopavo (turkey): 100542628Help
Entry
100542628         CDS       T01523                                 

Definition
mitogen-activated protein kinase 10-like
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Influenza A
Herpes simplex infection
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100542628
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100542628
   04012 ErbB signaling pathway
    100542628
   04310 Wnt signaling pathway
    100542628
   04068 FoxO signaling pathway
    100542628
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100542628
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100542628
   04621 NOD-like receptor signaling pathway
    100542628
   04622 RIG-I-like receptor signaling pathway
    100542628
  Endocrine system
   04910 Insulin signaling pathway
    100542628
   04920 Adipocytokine signaling pathway
    100542628
   04912 GnRH signaling pathway
    100542628
   04914 Progesterone-mediated oocyte maturation
    100542628
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100542628
   05164 Influenza A
    100542628
   05168 Herpes simplex infection
    100542628
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100542628
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100542628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 426 aa AA seqDB search
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDMWSVGCIMGEMVKGAVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSK
MLVIDPAKRISVDEALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEV
MNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSANDISSMSTDQTLASDTDSSLEASAG
PLGCCR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaagcaaagttgacaaccagttctacagcgtggaagtgggtgactcgaccttc
actgttctcaagcgctaccagaacttgaaaccaattggctctggggctcagggaatagtt
tgtgctgcatatgatgccatccttgatagaaacgtggccattaagaagctcagcagacca
ttccagaaccaaacccacgccaagcgtgcttacagagagctggtcctcatgaagtgtgtg
aatcacaaaaatattatcagtttattaaatgtcttcacgccacagaaatctctggaggag
ttccaggatgtttacctggtgatggagctgatggatgccaacctgtgccaggtgattcag
atggagctagaccatgagcgaatgtcctacctgctgtaccaaatgctctgcggcatcaag
cacctgcactctgcaggaattattcacagggatttaaaaccaagcaacattgtggtaaaa
tctgactgcacactgaagattttggattttgggctggccaggaccgcgggcaccagcttc
atgatgactccgtacgtggtgacacggtactacagagcaccggaggtcatcctgggaatg
ggctacaaggagaacgtcgacatgtggtcagtagggtgcatcatgggcgaaatggttaaa
ggtgcagtgttgtttcctggcaccgatcatattgaccagtggaataaagtcatagagcag
ttgggaacgccctgcccagagttcatgaagaagctgcagccaactgtacggaactacgtg
gagaaccggcccaagtatgctggcctcaccttccccaaactgtttcctgattctctcttc
ccagctgactcagaacacaacaaactcaaagccagccaagctcgggacctgctgtccaaa
atgctggtcatcgatccggccaagcgcatatcagtggacgaggccctgcagcacccatac
atcaacgtctggtacgaccccgccgaggtggaggcgccacctccccagatctatgacaag
cagctggacgagcgggagcacaccattgaggagtggaaagaactcatctacaaagaagta
atgaattctgaagaaaaaacgaaaaatggcgtagtaaaaggacagccatctccttcaggt
gcagcagtgaacagcagcgagagcctccccccatcctcatcggccaacgacatctcctcc
atgtccacggatcagacgctggcgtccgacacggacagcagcctggaagcgtcggcgggg
ccactggggtgctgcaggtga

DBGET integrated database retrieval system