KEGG   Meleagris gallopavo (turkey): 100542628Help
Entry
100542628         CDS       T01523                                 

Gene name
MAPK10
Definition
mitogen-activated protein kinase 10
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Adipocytokine signaling pathway
Salmonella infection
Influenza A
Herpes simplex infection
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100542628 (MAPK10)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100542628 (MAPK10)
   04012 ErbB signaling pathway
    100542628 (MAPK10)
   04310 Wnt signaling pathway
    100542628 (MAPK10)
   04068 FoxO signaling pathway
    100542628 (MAPK10)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100542628 (MAPK10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100542628 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100542628 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100542628 (MAPK10)
  Endocrine system
   04910 Insulin signaling pathway
    100542628 (MAPK10)
   04920 Adipocytokine signaling pathway
    100542628 (MAPK10)
   04912 GnRH signaling pathway
    100542628 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100542628 (MAPK10)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100542628 (MAPK10)
   05164 Influenza A
    100542628 (MAPK10)
   05168 Herpes simplex infection
    100542628 (MAPK10)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100542628 (MAPK10)
Protein kinases [BR:mgp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100542628 (MAPK10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 384 aa AA seqDB search
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSK
MLVIDPAKRISVDEALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEV
MNSEEKTKNGVVKGQPSPSAQVQQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaagcaaagttgacaaccagttctacagcgtggaagtgggtgactcgaccttc
actgttctcaagcgctaccagaacttgaaaccaattggctctggggctcagggaatagtt
tgtgctgcatatgatgccatccttgatagaaacgtggccattaagaagctcagcagacca
ttccagaaccaaacccacgccaagcgtgcttacagagagctggtcctcatgaagtgtgtg
aatcacaaaaatattatcagtttattaaatgtcttcacgccacagaaatctctggaggag
ttccaggatgtttacctggtgatggagctgatggatgccaacctgtgccaggtgattcag
atggagctagaccatgagcgaatgtcctacctgctgtaccaaatgctctgcggcatcaag
cacctgcactctgcaggaattattcacagggatttaaaaccaagcaacattgtggtaaaa
tctgactgcacactgaagattttggattttgggctggccaggaccgcgggcaccagcttc
atgatgactccgtacgtggtgacacggtactacagagcaccggaggtcatcctgggaatg
ggctacaaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgc
cacaaaatcctctttccaggaagggattatattgaccagtggaataaagtcatagagcag
ttgggaacgccctgcccagagttcatgaagaagctgcagccaactgtacggaactacgtg
gagaaccggcccaagtatgctggcctcaccttccccaaactgtttcctgattctctcttc
ccagctgactcagaacacaacaaactcaaagccagccaagctcgggacctgctgtccaaa
atgctggtcatcgatccggccaagcgcatatcagtggacgaggccctgcagcacccatac
atcaacgtctggtacgaccccgccgaggtggaggcgccacctccccagatctatgacaag
cagctggacgagcgggagcacaccattgaggagtggaaagaactcatctacaaagaagta
atgaattctgaagaaaaaacgaaaaatggcgtagtaaaaggacagccatctccttcagca
caggtgcagcagtga

DBGET integrated database retrieval system