KEGG   Meleagris gallopavo (turkey): 100542757Help
Entry
100542757         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-A-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100542757
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100542757
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100542757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 758 aa AA seqDB search
MAVRSATEPAGLCSCELCPELMAPRAINGLRCAQSDLARCYRKRSKTLLGAALYLTNHPG
TNLPASLIRFEASFSPPISRQTPLFSPRTRPGRFHTAPLLRSPSRPASTSPSGPAARPAE
LSRPAAERQEEPRGKREAQCVPGSPRHHGHSRKCRCAARVVRRAGGAGFPAGCPMADSSS
ERRPGSCNGGGAGARPNGSPVRAVRSSTRRPARVASAPLGCSRGSVLVPVTGMCRNCSHL
GRGRPEMGKRVKVGRSDPTVLLLALSEHAALGAKVAKSCICHMCGAHLNRLHSCLYCVFF
GCFTKKHIHEHAKTKRHNLAIDLLYGGIYCFMCQDYIYDKDMEQIAKEEQRKAWKLQAFT
PTVVSHYQCTMTGIGEKYSTWEPTKRELELLRHNPKRRKITTNCTIGLRGLINLGNTCFM
NCIVQALTHTPLLRDFFLSDRHKCEMQSPSSCLVCEMSTLFQEFYSGHRSPHIPYRLLHL
VWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQIFTGGLQS
DVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSDGSVVNGESHVSGTTTLTDCLR
RFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRRKITTYVS
FPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESGHYTSFIRQH
KDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgagaagtgccacggagccggcagggctctgcagctgtgagctctgccctgag
ctgatggcaccaagggcaatcaatggcctgaggtgtgcccagagcgaccttgctcggtgt
tacagaaagaggagtaaaacacttctaggagccgcgctgtatttgacgaatcaccctggc
acaaatcttcccgcctctttgattcggttcgaggcttcgttttccccccccatatcccgg
cagacgccgctgttctccccccgtacgcggcccggccgcttccacacagccccgcttcta
cgcagcccttcccggcccgcttccacctctccgagtggccccgcggctcgccctgcggag
ctgagtcggccggccgctgaacgacaggaggagccccgggggaagcgtgaggcacagtgc
gtacctggcagcccccgtcaccatggccacagccggaagtgccgctgtgctgcgcgcgtg
gtacggcgcgcaggaggggcgggatttccggcaggctgcccaatggcagatagctcctct
gagaggcgacccggaagttgtaacgggggaggggcgggtgctcggcccaatgggtccccc
gtgcgtgcggtccggtcgagcacgcgccgcccagcgcgcgtcgcctcggccccgctgggc
tgctcgcggggctccgtccttgtccccgtcactgggatgtgccggaactgctcgcacctg
ggccggggaaggccagagatggggaaacgggtgaaagtgggcaggtccgatcccacagtg
ctgctcctggcactatctgagcacgctgctcttggtgccaaggttgcaaagtcgtgcatt
tgtcatatgtgtggtgcccacctgaacagactccactcttgcctctactgtgtcttcttt
ggctgttttacaaagaaacatattcacgagcacgcaaagacaaagcgacacaatttagcc
atagaccttttgtatgggggtatatactgctttatgtgtcaagattacatatacgacaaa
gacatggaacaaattgccaaagaagaacaacgaaaagcttggaaattacaagccttcacc
ccaacagtggtttctcactaccagtgtacaatgacaggcattggagagaagtattcaaca
tgggagccaaccaaacgagagttagaattgctacgacacaaccccaagcggagaaaaata
accacaaactgcaccataggtctacgagggctaatcaatcttgggaacacatgttttatg
aactgtattgtccaggcacttacccacactccactgctgcgagatttcttcctctccgac
aggcacaaatgtgaaatgcaaagccccagctcatgtctggtctgtgaaatgtctacgctt
tttcaggagttttactctgggcaccgatctcctcacattccatataggttattgcacctg
gtatggactcatgcacggcatttagcagggtacgagcaacaagatgcacacgagttcctc
attgctgcattagatgtgctacacagacactgcaaaggtgatgataatgggaagaaggcc
aacaaccccaaccactgtaactgcatcatagaccaaatcttcacaggcggactacagtct
gatgttacctgtcaagtctgccatggcgtttccacaacgatagacccattttgggacatc
agtttggatttgccaggttcttccaccccgttctggcctctgagtccagggagtgatggc
agtgtcgtaaatggggaaagccatgtatcaggcaccaccactctcacagactgcttgcga
aggtttacaaggccagaacatctaggaagcagtgccaaaatcaaatgtagtggttgccat
agctaccaggaatctaccaaacaactcactatgaagaaattacccattgtggcctgtttt
catctcaaacggtttgaacactcagccaaactgaggcggaagatcactacgtatgtctca
tttccactggagctggacatgacaccattcatggcttccagtaaagagagcagaatgaac
gggcagtaccagcagccgacggatagtctaaacaatgataataagtattccttgtttgca
gtagttaatcaccagggaaccttggagagtgggcactataccagcttcatccggcagcac
aaggaccagtggttcaagtgtgatgatgccattatcaccaaggctagcattaaggatgta
ctagacagtgaaggatatttgctgttctatcacaaacagttcctggagtatgaatag

DBGET integrated database retrieval system