KEGG   Meleagris gallopavo (turkey): 100542779Help
Entry
100542779         CDS       T01523                                 

Definition
glutamate receptor 4-like
Orthology
K05200  
glutamate receptor 4
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100542779
Ion channels [BR:mgp04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   100542779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 739 aa AA seqDB search
YSILQAIMEKAGQNSWQVSAICVENFNDASYRRLLEDLDRRQEKKFVIDCEIERLQNLLE
QIVSVGKHVKGYHYIVANLGFKDISLERFMHGGANVTGFQLVDFSTPMVTKLMQRWKKLD
QREYPGSETPPKYTSALTYDGVLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWGQGI
DMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKNTGPRKVGYWNDMDKLVLIQHEP
TLGNDTSAMENRTVVVTTILEAPYVMFKKNHDTFEGNDKFEGYCVDLASEIAKHIGIKYK
IAIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGIS
IMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKE
GPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLA
AFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMKSAEPSV
FTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSP
LRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVG
GLGLAMLVALIEFCYKSRAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVH
SGTAIRQSSGLAVIASDLP
NT seq 2222 nt NT seq  +upstreamnt  +downstreamnt
gttattcaatacttcaagctattatggaaaaagcaggacaaaatagctggcaagtcagtg
ccatctgcgtggagaatttcaatgatgccagctacaggcggcttttagaagacctggacc
gaagacaagaaaagaaatttgtgatagactgtgaaatagagaggctgcagaatctcttag
aacagattgtgagcgtgggaaagcatgttaaaggataccattacattgttgccaacttgg
gattcaaagatatttctctggagaggtttatgcatggaggagctaatgtgacgggatttc
agctagtagatttcagtaccccaatggtaactaagttgatgcagcgctggaagaagctgg
accagagagaatatccaggatctgagactccaccaaagtatacatctgcattaacatatg
atggagtgcttgtgatggctgaaactttccgcaatcttagaaggcagaaaatagatattt
caagaagaggaaatgctggtgattgtcttgctaatcctgctgccccgtggggtcaaggaa
ttgatatggagaggacattgaaacaggttcgaatacaaggattgacaggaaacgttcaat
ttgaccactatggtcgcagagtcaactacactatggatgtctttgagctgaagaacacag
gtcctcggaaggttggttactggaatgacatggataaattagttctgattcagcatgaac
ctacacttggaaatgacacttcagccatggagaacagaactgtagttgtcactacaattt
tggaagccccatatgttatgttcaagaaaaaccatgatacgtttgaagggaatgacaagt
ttgaaggatactgtgtagatctggcgtcagaaattgcaaaacatattggtatcaagtaca
aaattgccattgttcctgatggaaaatatggagcaagggatccagagacaaaaatctgga
atgggatggtgggagaacttgtttatgggaaagcagagattgctgttgcgcctctgacca
tcactttggtacgagaagaggtcattgatttttctaagccttttatgagtttggggatat
ccattatgatcaaaaagccccagaaatctaaaccaggagtattttccttcttggaccctt
tggcgtatgagatctggatgtgcatagtctttgcctacattggtgtcagtgtggtcctgt
tcctagttagcaggtttagtccatacgagtggcatacagaagaaccagaggatgggaaag
aaggacccagtgatcagcctcccaatgaatttggcatattcaacagcctctggttttccc
tgggtgcctttatgcaacaaggatgtgatatttccccaagatccctctcaggtcgcattg
ttggaggtgtctggtggttcttcacgctcatcattatttcatcctacactgctaacctcg
ctgctttcttgactgttgagcgaatggtctcacccatagaaagtgcagaagaccttgcca
aacaaactgaaattgcttacgggacactggactcagggtcaaccaaagagttcttcagaa
gatcaaaaatagcagtgtatgaaaagatgtggacctacatgaaatcagcagagccgtcag
tgttcactaggactactgcagagggagtagctcgtgtccgcaaatccaagggcaagtttg
ccttcctgctggagtccaccatgaatgaatacattgagcaacgaaagccttgtgacacca
tgaaagtgggaggaaatctggattcgaaaggctatggcgtagccacaccgaagggttctc
cattaagaaatgctgttaacctcgcagttttaaaactgaatgaacaaggcctcttggaca
aattgaaaaacaaatggtggtacgacaaaggagaatgtggcagcgggggaggtgactcca
aggacaagacgagtgccttgagtctcagcaacgttgctggagtcttctacattctggttg
gaggcttgggcttggcaatgctggtggctttgatagagttctgttacaagtccagggcag
aggcgaagcgaatgaagcttaccttttctgaagccataagaaacaaagccagattatcca
tcacggggagtgtgggtgaaaatggccgcgtattgactcccgactgcccgaaggctgtgc
attccggaactgcaattagacaaagttcaggattggctgtaatcgcatcggacctaccat
aa

DBGET integrated database retrieval system