KEGG   Meleagris gallopavo (turkey): 100542779Help
Entry
100542779         CDS       T01523                                 

Definition
(RefSeq) glutamate receptor 4-like
Organism
mgp  Meleagris gallopavo (turkey)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
1
AA seq 181 aa AA seqDB search
MHGGANVTGFQLVDFSTPMVTKLMQRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETF
RNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNY
TMDVFELKNTGPRKVGYWNDMDKLVLIQHEPTLGNDTSAMENRTVVVTTILPLMKNPILR
N
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcatggaggagctaatgtgacgggatttcagctagtagatttcagtaccccaatggta
actaagttgatgcagcgctggaagaagctggaccagagagaatatccaggatctgagact
ccaccaaagtatacatctgcattaacatatgatggagtgcttgtgatggctgaaactttc
cgcaatcttagaaggcagaaaatagatatttcaagaagaggaaatgctggtgattgtctt
gctaatcctgctgccccgtggggtcaaggaattgatatggagaggacattgaaacaggtt
cgaatacaaggattgacaggaaacgttcaatttgaccactatggtcgcagagtcaactac
actatggatgtctttgagctgaagaacacaggtcctcggaaggttggttactggaatgac
atggataaattagttctgattcagcatgaacctacacttggaaatgacacttcagccatg
gagaacagaactgtagttgtcactacaattttgcctctgatgaagaatcctattttaaga
aattga

DBGET integrated database retrieval system