KEGG   Meleagris gallopavo (turkey): 100542845Help
Entry
100542845         CDS       T01523                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mgp01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mgp00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mgp00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 444 aa AA seqDB search
MGGRSKGNCTLARRSLSGVAGSQGLAYIDSRKLIVNSSSVFTVRYFRTTAVHRDDVITVN
TPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPAPAAGVIEALLVPDGGKV
EGGTPLFKLRKTGAAPAKAKPAAAPPPPPAAPEPVAAAPPSPAAAPIPTAMPPVPPVSAQ
PIDSKPVSAVKPAAAPVAAPPGEAVPSKGARSEHRVKMNRMRQRIAQRLKEAQNTCAMLT
TFNEIDMSNIREMRAVHKDPFLKKHNLKLGFMSAFVKASAFALQDQPVVNAVIDDTTKEI
VYRDYVDISVAVATPRGLVVPVVRNVENMNFADIERAIYELGEKARKNELAIEDMDGGTF
TISNGGVFGSLFGTPIINPPQSAILGMHAIFDRPVAVGGKIEIRPMMYVALTYDHRLIDG
REAVTFLRKIKAAVEDPRVLLLDL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgggaggacgcagcaagggcaactgtactctggcaaggcgctccctgtctggtgtggct
ggcagccagggactggcctacatcgacagcaggaagctcatagtaaatagctccagtgtc
ttcactgtccgttacttcagaaccacagcagtacatagggatgacgtgattacggtgaac
accccagcttttgcagagtcagtcacagaaggagatgtcaggtgggagaaagctgttgga
gacacagtggcggaagatgaagtggtgtgtgagattgaaacagacaagacatcagtgcaa
gttccagccccagcagctggtgtgattgaagcccttttggtacctgatggtggcaaagtg
gaaggagggacacctctgttcaaactcaggaaaactggagctgctcctgccaaggccaaa
ccagcagcagcccctcctcctcctcctgcagcacctgaacctgtagctgcagctcctcct
tctcctgctgcagcaccaattcccactgcaatgccaccagtgccacctgtgtcagctcag
cccattgacagcaaaccagtgtctgcagtgaagccggctgcagctccagtggcagcccct
cctggggaggcagtgcccagcaaaggtgccagatctgagcatagggtgaaaatgaatagg
atgcgtcagcgtatcgcccagcggctgaaggaggctcagaacacttgtgccatgctgacc
actttcaatgagatcgatatgagcaacatccgggagatgagagctgtacacaaggatcct
ttcctgaaaaagcacaacctgaaattaggtttcatgtcagcttttgtgaaagcttcagct
tttgctctgcaggaccagcctgttgtgaatgcagtaattgatgacacgaccaaagagatt
gtgtacagggactatgtggacatcagtgtagctgtagcaactccccggggtcttgtggtc
cctgttgttaggaatgtagaaaatatgaactttgctgacatagagcgagctatctatgag
ttgggggaaaaggcacggaagaacgaactggctatcgaagacatggatggtggcactttc
acaatcagcaatggaggggtttttgggtcactctttgggacacctatcatcaacccaccg
cagtctgctatcttaggcatgcatgccatctttgacaggcctgtggctgtgggaggcaag
atcgagatccggcccatgatgtacgtggcactgacctacgatcaccggctgattgatggc
agagaggcagtgactttcctgcgcaagatcaaggcagcggtggaggatccccgcgtgctg
ctgctcgacctgtag

DBGET integrated database retrieval system