KEGG   Meleagris gallopavo (turkey): 100542845Help
Entry
100542845         CDS       T01523                                 

Gene name
DLST
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100542845 (DLST)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100542845 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    100542845 (DLST)
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100542845 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 439 aa AA seqDB search
QGNCTLARRSLSGVAGSQGLAYIDSRKLIVNSSSVFTVRYFRTTAVHRDDVITVNTPAFA
ESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPAPAAGVIEALLVPDGGKVEGGTP
LFKLRKTGAAPAKAKPAAAPPPPPAAPEPVAAAPPSPAAAPIPTAMPPVPPVSAQPIDSK
PVSAVKPAAAPVAAPPGEAVPSKGARSEHRVKMNRMRQRIAQRLKEAQNTCAMLTTFNEI
DMSNIREMRAVHKDPFLKKHNLKLGFMSAFVKASAFALQDQPVVNAVIDDTTKEIVYRDY
VDISVAVATPRGLVVPVVRNVENMNFADIERAIYELGEKARKNELAIEDMDGGTFTISNG
GVFGSLFGTPIINPPQSAILGMHAIFDRPVAVGGKIEIRPMMYVALTYDHRLIDGREAVT
FLRKIKAAVEDPRVLLLDL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
cagggcaactgtactctggcaaggcgctccctgtctggtgtggctggcagccagggactg
gcctacatcgacagcaggaagctcatagtaaatagctccagtgtcttcactgtccgttac
ttcagaaccacagcagtacatagggatgacgtgattacggtgaacaccccagcttttgca
gagtcagtcacagaaggagatgtcaggtgggagaaagctgttggagacacagtggcggaa
gatgaagtggtgtgtgagattgaaacagacaagacatcagtgcaagttccagccccagca
gctggtgtgattgaagcccttttggtacctgatggtggcaaagtggaaggagggacacct
ctgttcaaactcaggaaaactggagctgctcctgccaaggccaaaccagcagcagcccct
cctcctcctcctgcagcacctgaacctgtagctgcagctcctccttctcctgctgcagca
ccaattcccactgcaatgccaccagtgccacctgtgtcagctcagcccattgacagcaaa
ccagtgtctgcagtgaagccggctgcagctccagtggcagcccctcctggggaggcagtg
cccagcaaaggtgccagatctgagcatagggtgaaaatgaataggatgcgtcagcgtatc
gcccagcggctgaaggaggctcagaacacttgtgccatgctgaccactttcaatgagatc
gatatgagcaacatccgggagatgagagctgtacacaaggatcctttcctgaaaaagcac
aacctgaaattaggtttcatgtcagcttttgtgaaagcttcagcttttgctctgcaggac
cagcctgttgtgaatgcagtaattgatgacacgaccaaagagattgtgtacagggactat
gtggacatcagtgtagctgtagcaactccccggggtcttgtggtccctgttgttaggaat
gtagaaaatatgaactttgctgacatagagcgagctatctatgagttgggggaaaaggca
cggaagaacgaactggctatcgaagacatggatggtggcactttcacaatcagcaatgga
ggggtttttgggtcactctttgggacacctatcatcaacccaccgcagtctgctatctta
ggcatgcatgccatctttgacaggcctgtggctgtgggaggcaagatcgagatccggccc
atgatgtacgtggcactgacctacgatcaccggctgattgatggcagagaggcagtgact
ttcctgcgcaagatcaaggcagcggtggaggatccccgcgtgctgctgctcgacctgtag

DBGET integrated database retrieval system