KEGG   Meleagris gallopavo (turkey): 100542845Help
Entry
100542845         CDS       T01523                                 

Gene name
DLST
Definition
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100542845 (DLST)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100542845 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    100542845 (DLST)
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100542845 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 439 aa AA seqDB search
QGNCTLARRSLSGVAGSQGLAYIDSRKLIVNSSSVFTVRYFRTTAVHRDDVITVNTPAFA
ESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPAPAAGVIEALLVPDGGKVEGGTP
LFKLRKTGAAPAKAKPAAAPPPPPAAPEPVAAAPPSPAAAPIPTAMPPVPPVSAQPIDSK
PVSAVKPAAAPVAAPPGEAVPSKGARSEHRVKMNRMRQRIAQRLKEAQNTCAMLTTFNEI
DMSNIREMRAVHKDPFLKKHNLKLGFMSAFVKASAFALQDQPVVNAVIDDTTKEIVYRDY
VDISVAVATPRGLVVPVVRNVENMNFADIERAIYELGEKARKNELAIEDMDGGTFTISNG
GVFGSLFGTPIINPPQSAILGMHAIFDRPVAVGGKIEIRPMMYVALTYDHRLIDGREAVT
FLRKIKAAVEDPRVLLLDL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
cagggcaactgtactctggcaaggcgctccctgtctggtgtggctggcagccagggactg
gcctacatcgacagcaggaagctcatagtaaatagctccagtgtcttcactgtccgttac
ttcagaaccacagcagtacatagggatgacgtgattacggtgaacaccccagcttttgca
gagtcagtcacagaaggagatgtcaggtgggagaaagctgttggagacacagtggcggaa
gatgaagtggtgtgtgagattgaaacagacaagacatcagtgcaagttccagccccagca
gctggtgtgattgaagcccttttggtacctgatggtggcaaagtggaaggagggacacct
ctgttcaaactcaggaaaactggagctgctcctgccaaggccaaaccagcagcagcccct
cctcctcctcctgcagcacctgaacctgtagctgcagctcctccttctcctgctgcagca
ccaattcccactgcaatgccaccagtgccacctgtgtcagctcagcccattgacagcaaa
ccagtgtctgcagtgaagccggctgcagctccagtggcagcccctcctggggaggcagtg
cccagcaaaggtgccagatctgagcatagggtgaaaatgaataggatgcgtcagcgtatc
gcccagcggctgaaggaggctcagaacacttgtgccatgctgaccactttcaatgagatc
gatatgagcaacatccgggagatgagagctgtacacaaggatcctttcctgaaaaagcac
aacctgaaattaggtttcatgtcagcttttgtgaaagcttcagcttttgctctgcaggac
cagcctgttgtgaatgcagtaattgatgacacgaccaaagagattgtgtacagggactat
gtggacatcagtgtagctgtagcaactccccggggtcttgtggtccctgttgttaggaat
gtagaaaatatgaactttgctgacatagagcgagctatctatgagttgggggaaaaggca
cggaagaacgaactggctatcgaagacatggatggtggcactttcacaatcagcaatgga
ggggtttttgggtcactctttgggacacctatcatcaacccaccgcagtctgctatctta
ggcatgcatgccatctttgacaggcctgtggctgtgggaggcaagatcgagatccggccc
atgatgtacgtggcactgacctacgatcaccggctgattgatggcagagaggcagtgact
ttcctgcgcaagatcaaggcagcggtggaggatccccgcgtgctgctgctcgacctgtag

DBGET integrated database retrieval system