KEGG   Meleagris gallopavo (turkey): 100542964Help
Entry
100542964         CDS       T01523                                 

Gene name
ACSS2
Definition
acyl-CoA synthetase short-chain family member 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mgp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mgp00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mgp00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mgp00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
22
AA seq 663 aa AA seqDB search
MEAMTALAEFWGDVAKEFYWKEQHSGPFLRYNFDVTKGKIFIEWMKGAKTNICYNLLDRN
VGEKKLGDKVAFYWEGNEPGDSMKITYGELLRKVCQFANVLRNHGVKKGDRISIYLPMIL
ELVVAMLACARIGAIHSVVFAGFSADSLCERILDCGCSLLITADAFYRGDKLVNLKQIAD
EALQKSKDKGFSLKKCIVVKHLGREEVAADGACSQSPPLKRLCQDVQEKKTESSQRLHPK
VPWDPHMDVWWHDLMSSASMECEPEWCDSEDELFILYTSGSTGKPKGVLHTVGGYMLYAS
TSFKYVFDYQPEDIYWCTADIGWITGHSYITYGPLANGATSVLFEGIPTYPDAGRMWSII
DKYKVTKFYTAPTAIRLLMKCGEEPVKKHSRKSLKVLGTVGEPINPEAWLWYYRVVGEER
CPIVDTFWQTETGGHMLTPLPAATPMKPGSATFPFFGVVPAVMNESGEELEGEAEGYLVF
KQPWPGIMRTLYGNHQQFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHL
LSTAEVESALLGHGAVSEAAVVSHPHPLKGECLYCFVTLKDGHEFTKDLADELKKQVREK
IGPIATPDYIQYAPSLPKTRSGKITRRILRKIAQNDRDLGDISTLVNPGIINQLFNNRCD
TKL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaatgacagcgctggctgaattctggggtgacgtcgccaaggagttctactgg
aaggagcagcactcggggccgttcctcaggtacaacttcgatgtgacgaaggggaagatc
ttcatcgagtggatgaaaggggcgaagaccaacatctgctacaacctcctggacaggaac
gtcggtgagaagaaactcggcgacaaagtggctttttattgggaagggaatgaaccgggg
gattctatgaagatcacatatggcgagttgctgcgcaaagtctgtcagtttgccaatgtc
ctccgtaatcacggtgtgaagaaaggtgaccgaatctccatctacctgccgatgatcctg
gagctggtcgtagccatgctcgcctgtgccaggattggagccatccactctgttgtgttt
gcaggtttctcagcagactctctttgtgagcggatcctcgactgcggttgctccctcctc
attacggcagatgccttttatcgaggggacaagctggtcaacctgaagcagattgcagat
gaagctctccagaagagcaaagacaagggcttctctttgaagaagtgcattgtggtgaag
cacctgggacgggaggaggtagcagcggacggggcatgcagccaatctcctcctctcaaa
aggctgtgccaggacgtgcaggaaaaaaagactgagagctcacagagactccatcccaag
gtcccctgggatccacacatggatgtgtggtggcatgatctaatgagcagtgccagcatg
gagtgtgagcctgaatggtgcgactccgaggatgaactcttcattctctacacaagtggc
tcaactggaaaacccaagggtgtgctgcatacagtgggtggatacatgctttatgcttcc
acttcatttaagtatgtctttgactaccagcctgaggacatctactggtgcacagctgac
attggatggataacaggccattcctacatcacttatggacccttggcaaatggggcaact
agcgtattatttgaaggtatccccacctacccggacgctgggcgaatgtggagtatcatt
gacaagtacaaggtgaccaagttctacacggcacccacagccatccggctgctgatgaag
tgtggggaggagcctgtcaaaaagcacagccggaagtctctgaaggtgctggggaccgtt
ggtgagcccatcaaccccgaagcctggctgtggtactaccgtgtggtgggagaggagagg
tgtcccattgtggacacgttctggcagacggagacgggtggccacatgcttacgcctctc
cctgccgccacccccatgaaaccaggctctgctacgttccccttctttggagtggtccct
gccgtcatgaacgagtcgggggaagagctggaaggagaagcagaaggctacttggtattt
aagcagccctggccgggaataatgcgcacactgtatggaaaccaccagcagtttgaaacc
acgtacttcaagaagttccctgggtactacgtgacaggtgatggttgcaggagagataaa
gatggttattactggatcacagggcgaatcgatgacatgctgaatgtttctggccacttg
ctgagcactgcagaagtggagtcagctctgcttgggcatggagccgtctctgaggccgct
gtggtcagccacccacatcccctgaaaggcgagtgcctctactgcttcgtgaccctgaaa
gatggccatgaattcaccaaggacctggcagatgagctgaaaaaacaagtcagggaaaaa
atcggaccgatagcaacgcctgattacatccagtatgcccccagcctgcccaaaacccgt
tcaggaaagatcaccaggcggatactaaggaagattgcccaaaatgacagagatctgggg
gacatctccaccttggtaaacccaggcattataaaccagcttttcaacaatagatgtgac
accaaactgtag

DBGET integrated database retrieval system